SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000008480 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000008480
Domain Number 1 Region: 38-501
Classification Level Classification E-value
Superfamily Sema domain 7.72e-133
Family Sema domain 0.0000195
Further Details:      
 
Domain Number 2 Region: 1369-1472,1667-1856
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.41e-50
Family p120GAP domain-like 0.032
Further Details:      
 
Domain Number 3 Region: 1033-1137
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000344
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.076
Further Details:      
 
Domain Number 4 Region: 946-1034
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000853
Family Other IPT/TIG domains 0.019
Further Details:      
 
Domain Number 5 Region: 849-947
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000334
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 6 Region: 504-555
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000654
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 1153-1224
Classification Level Classification E-value
Superfamily E set domains 0.000021
Family E-set domains of sugar-utilizing enzymes 0.053
Further Details:      
 
Domain Number 8 Region: 803-835
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000392
Family Plexin repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000008480   Gene: ENSPSIG00000007550   Transcript: ENSPSIT00000008524
Sequence length 1886
Comment pep:known_by_projection scaffold:PelSin_1.0:JH208026.1:932083:1237839:-1 gene:ENSPSIG00000007550 transcript:ENSPSIT00000008524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLRLKQHLSVNIWTLLLLGSAWLPLAEGTPKSPFRTFSVTDWSLTHLVVHNKTGEVYV
GAVNRIYKLSNNLTLLRAHVTGPVDDNEKCYPPPSVQSCPHGLVTTNNVNKLLLVDYSEN
RLIACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVNESGTMSGVIIEVLNGHNKLFI
GTPIDGKSEYFPTLSSRKLMANEENAEMFGFVYQDEFVSSQLKIPSDTLSKFPTFDIYYI
YSFSSEQFVYYLTLQLDTQLTSPDSTGEQFFTSKIVRLCVDDPKFYSYVEFPIGCVRDGV
EYRLIQDAYLSKPGKELAKQLGISEQEDILFTVFSQGQKNRVKPPKESILCLFTLKKIKD
KIKERIQSCYRGEGKLSLPWLLNKELGCINSPLQIDDYFCGQDFNQPLGGTVTIEGTALF
VDKEDGMTSVAAYDYRGHTVVFAGTRSGRIKKILVDLSNSSKQYENVVAHEGSSILRDLV
LSPDRQHIYAMTEKQVTRVPVESCEQYKSCALCLGSKDPHCGWCVLHNICSRKDRCERAD
EPQRFASDLKQCVELTVQPKNISVTMSEVSLVLQAWNVPDLSAGVNCSFEDFTESESRIE
DGRIYCSSPSAKDVIPITRGRGDKRVVKLYLKSKETGKKFAAVDFIFYNCSVHQSCLSCV
NGSFPCHWCKYRHICTHNAADCSFQEGRVNMSEDCPQILPSTQIYIPVGVVKPITLTAKN
LPQPQSGQRNYECIFHIPGSATRVTALRFNSTSIQCQNTSYFYEGNDISDLPVNLSVVWN
GNFVIDNPQNIQAHLYKCSALRESCGLCLKADPRFECGWCVTEKRCSLRQHCPASESSWM
HASNGNSRCTGPKISQLSPETGPRQGGTRLTITGENLGLKFEDVRSGVRVGKVMCIPIES
EYISAEQIVCEIGDASPSRAHDARVEVCIRDCSPSYKATSPKSFTFVMPTFYRVTPARGP
LSGGTWISVEGSHLNAGSDVTVTIGGRPCAFSWRNAREIRCRTPPGQSPGGSPILININR
AELSNHEVKYNYTEDPTVQKIDPEWSIKSGGTLLTVIGTNLATIKEPRIRAKYGNAEREN
NCTVYNDTTMLCYAPSIDNPSRSPPEIGDRPDEIGFVMDNVQALLIVNTTNFVYYPDPVF
EPLSASGMLELKPSSPLILKGRNLLPPAAGNSRLNYTVLIGDTPCALTVSETQLLCESPN
LTGQHKVTIKAGGFEFSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLIIIIVLIAYKRKSR
DADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTNDLDGAGIPFLDYRTYAMRVL
FPGIEDHPVLKEMEIVGNVEKSSGVVFSQRRHSEMMVTFWLHTFEIKQRSFSMRDRGNVA
SLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLY
KFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKMLTLNCVNP
ENENAPEIPVKVLNCDTITQVKEKLLDAVYKGVPYSQRPKAGDMDLEWRQGRMARIILQD
EDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQNSAYNISNSSTFTKSLSRYESMLRTA
SSPDSLRSRTPMITPDLESGTKLWHLVKNHDHMDQREGDRGSKMVSEIYLTRLLATKGTL
QKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQINDYDVRHTWKSNCLPLRFW
VNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSPSNKLLYAKDIPNYK
SWVERYYADIAKMPAISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYITKYKDEILAAL
EKDEQARRQRLRSKLEQAIDTMALSS
Download sequence
Identical sequences K7FKC0
ENSPSIP00000008480 ENSPSIP00000008480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]