SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000008815 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000008815
Domain Number 1 Region: 334-596
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-72
Family Nuclear receptor ligand-binding domain 0.000000000133
Further Details:      
 
Domain Number 2 Region: 261-339
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.36e-28
Family Nuclear receptor 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000008815   Gene: ENSPSIG00000008054   Transcript: ENSPSIT00000008861
Sequence length 598
Comment pep:known_by_projection scaffold:PelSin_1.0:JH209427.1:6290894:6296711:-1 gene:ENSPSIG00000008054 transcript:ENSPSIT00000008861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSF
STFMDNYSTSYDVKPPCLYQMPLSGQQSSIKVEDIPMHSYQQHNHLPPQSEEMMPHSGSV
YYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQ
SPPGTPVSSCQMRFDGPLHVPMNPEPSGAHHVVDGQTFAVPNPIRKQASMGFPGLQIGHA
SQLLDTQVPSPPARGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCL
ANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSP
PVSLISALVRAHVDSNPAMSSLDYSRFQANPDYQMNGDDTQHIQQFYDLLTGSMEIIRGW
AEKIPGFTDLPKPDQDLLFESAFLELFVLRLAYRSSPVEGKLIFCNGVVLHRLQCVRGFG
EWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVT
FNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Download sequence
Identical sequences K7FLA5
ENSPSIP00000008815 XP_006125718.1.96668 ENSPSIP00000008815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]