SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000008839 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000008839
Domain Number 1 Region: 130-408
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.72e-79
Family Nuclear receptor ligand-binding domain 0.0000000014
Further Details:      
 
Domain Number 2 Region: 77-156
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.99e-27
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000008839   Gene: ENSPSIG00000007930   Transcript: ENSPSIT00000008885
Sequence length 448
Comment pep:known scaffold:PelSin_1.0:JH212176.1:5955237:6112557:-1 gene:ENSPSIG00000007930 transcript:ENSPSIT00000008885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDCMDVLAVSPGQILDFYTASPSSCMLQEKALKACFSGLAQTDWQHRHSAQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQEFTENYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTSLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPAKVDKLQEPLLEALKIYIRKRR
PNKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS
SGNTAEHSPSISPSSVDNSSVSQSPLVQ
Download sequence
Identical sequences K7FLC9
ENSPSIP00000008839 XP_006134380.1.96668 ENSPSIP00000008839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]