SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000009081 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000009081
Domain Number 1 Region: 537-753
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-52
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 234-378
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-42
Family Third domain of FERM 0.0005
Further Details:      
 
Domain Number 3 Region: 889-1032
Classification Level Classification E-value
Superfamily PH domain-like 9.11e-34
Family Pleckstrin-homology domain (PH domain) 0.0018
Further Details:      
 
Domain Number 4 Region: 739-866
Classification Level Classification E-value
Superfamily PH domain-like 9.76e-31
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 5 Region: 133-233
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-26
Family Second domain of FERM 0.00015
Further Details:      
 
Domain Number 6 Region: 54-133
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.51e-20
Family First domain of FERM 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000009081   Gene: ENSPSIG00000008274   Transcript: ENSPSIT00000009127
Sequence length 1052
Comment pep:known_by_projection scaffold:PelSin_1.0:JH204968.1:226573:357990:-1 gene:ENSPSIG00000008274 transcript:ENSPSIT00000009127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEGTYRVLQTPGSRLGVQKNTGVSTLEPDQNLSTSIAMTPAKMHERDLSIKLKLLDN
TVEVLNVESKSYGQTLLTEIYKHLNLVESDYFGIEFQNIQSYWIWLEPMKPIIKQVRRPK
NTMLRLAVKFFPPDPGQLQEEYTRYLFALQIKRDLAEERLTCSDNTAALIISHLLQSEIG
DFDESGDRSHLKTNQYLPNQERVQGKILEFHRKHLGQTPAESDFQVLEIARKLEMYGIRF
HLASDREGSKINLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQ
DTLEFLLGSRDECKNFWKICVEYHTFFRLFDQPKPKAKTVFFSRGSSFRYSGRTQKQLVN
YVKDSGMKKTPYERRHSKARVSAHTSNVDVPKQSVSFTEGLGVPVSHASVSASFHSVYVS
STTDLSVCSEMNNSSRDPRALYTRSPTTEKSTATPAEETGKKATQQPGSPILQSFQGLSM
IHPQLSSFTLKNPQSLNPTFQVNLNPADQGSSPLLSPVLSDAGSSRVEEEEEVKRKRYPA
DKAYFVAKEILATERTYVKDLEVITVWFRSAVIKENAMPEGLMTLLFSNIDPIYEFHRSF
LKEMEQRLALWEGRSNAHVKGDYQRIGDIMLRNMCMLKEFTGYLQKHDEVLTELEKATKR
LKKLEMVYREFELQKVCYLPLNTFLLKPIQRLMHYKLILGRLCKHYPVEHRDYSDCRKAL
KEITELTSWLENSLIRLENFQKLTELQHDLIGIDNLVAPGREFIREGCLYKLTKKGLQQR
MFFLFSDMLLYTSKGVTGTNQFKIHGHLPLHGMLVEESENEWSVPHCFTIYSAQKTIVVA
ACTRLEMGKWMEDLNVAIEMAKKSSNKSKVFLESSMYNRSNRSSDEVSLEQESEDDIQSS
RSSLDRQSHHRANTTMHVCWYRNTSVSMTDHSVAVENQLSGYLLRKFKNSDGWQKLWVVF
TNFCLFFYKTHQDDYPLASLPLLGYSVSAPTEADGVQKDYVFKLQFKSHVYFFRAESKYT
FERWMEVIQRATNSPGRSSPAIPMEEKDIHTD
Download sequence
Identical sequences K7FM21
ENSPSIP00000009081 XP_006110686.1.96668 ENSPSIP00000009081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]