SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000009088 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000009088
Domain Number 1 Region: 267-513
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.31e-68
Family Nuclear receptor ligand-binding domain 0.000000000514
Further Details:      
 
Domain Number 2 Region: 181-246
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000255
Family Nuclear receptor 0.0000288
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000009088
Domain Number - Region: 121-143
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000202
Family Nuclear receptor 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000009088   Gene: ENSPSIG00000008182   Transcript: ENSPSIT00000009134
Sequence length 515
Comment pep:novel scaffold:PelSin_1.0:JH212176.1:6888721:6920786:1 gene:ENSPSIG00000008182 transcript:ENSPSIT00000009134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYCMQEIYEVHPAAGSNCYMQSADYCTYIEDSQSYSSCDAQVLHNNNIYMEQAWAVNQP
YTCSYPGNVFKSEYSDMDMALNQYNQPEYFTEEKPTFSQVQSPSYSQKKGYIPSYLDKDE
LCVVCGDKATGYHYRCITCEGCKKKSHVYQEARFVWFWQNATATSVLCLIILHTSRCFPL
GFFRRTIQKNLHPTYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVLDDSKRLAK
RKLIEENREKRRREELQKTVGHKPEPTDEEWELIKIVTEAHVATNAQGSHWKQKRKFLPE
DIGQAPMVNAPESGKVDLEAFSQFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGC
CMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSSFNLDDT
EVALLQAVLLMSSATDRPGLLSVERIEKCQEGFLLAFEHYINYRKHHVAHFWPKLLMKVT
DLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Download sequence
Identical sequences K7FM28
ENSPSIP00000009088 ENSPSIP00000009088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]