SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000009783 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000009783
Domain Number 1 Region: 253-379
Classification Level Classification E-value
Superfamily Second domain of FERM 7.33e-32
Family Second domain of FERM 0.002
Further Details:      
 
Domain Number 2 Region: 381-485
Classification Level Classification E-value
Superfamily PH domain-like 8.11e-25
Family Third domain of FERM 0.0059
Further Details:      
 
Domain Number 3 Region: 14-116
Classification Level Classification E-value
Superfamily PDZ domain-like 1.09e-16
Family PDZ domain 0.012
Further Details:      
 
Domain Number 4 Region: 163-246
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000192
Family Ras-binding domain, RBD 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000009783   Gene: ENSPSIG00000008810   Transcript: ENSPSIT00000009831
Sequence length 1272
Comment pep:known_by_projection scaffold:PelSin_1.0:JH208694.1:550144:722656:1 gene:ENSPSIG00000008810 transcript:ENSPSIT00000009831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTNRDGRDYFINHMTPSATFEDPRIESCPITPPAPRKVEMRRDPVLGFGFVAGSEKPVV
VRSVTPGGPSEGKLIPGDQIIMINDEPVSTAPRERVIDLVRSCKESILLTVVQPYPSPKS
AFISAAKKARLKSNPVKVRFSEEVIINGQVSETVKDNSLLFMPNVLKVYLENGQTKSFRF
DCSTSIKDVILTLQEKLSIKCIEHFSLMLEQRIEGAGTKLLLLHEQETLAQVTQRPSSHK
MRCLFRISFVPRDPIDLLRRDPVAFEYLYVQSCNDVVQERFGPELKYDIALRLAALQMYI
ATVTTRQTQKISLKYVEKEWGLETFLPSAVLQSMKEKNIKKALSHLVKANQNLVPPGKKL
SALQAKVHYLKFLSDLRLYGGRVFKATLVQGEKRSEVTLLVGPRYGISHVINTKTNLVAL
LADFSHVNRIEMFTEDENTVRVELHVLDVKPITLLMESSDAMNLACLTAGYYRLLVDSRR
SIFNMANKKNAGNRETGTENRGKHNLHASEWNCVPKTTTFMAEGDHEVQITFVDPKQKTS
EISEIPMCQKDHRHLYIENTYNSGGLDQVLTKQDDSTEVGENRSLNQQSSLSPSGVESTK
KTQDSPRGAKVSFIFGDHSLDGISPQTLGYERLLDDSPEVLDKQRAIYISNTNDIKGLEL
SPDVESIQFATNSVYASINDGKIFGAAEGIEEPLLHDICYAENTDDAEDEDEVSCEEDIM
VGEISRPAILSLSGSSDDIIDLTSLPPPEGDDNEDDFLLHSLNMAIAAPPPGFRDSSDEE
DSQNQTTQYIEDKEQASNLGNDDIPVSLIDTVPTNTEGKCDKGLDDAVVSTLQALEALAA
SEEQQTNGNSGVAILRAYSPESSSDSGNETNSSEMTESSELTTAQRQSENSTRIFLTTSE
GYQPLVEEQTEFPIAKNQTGGPLAKSSQSIAGCQAAELQSKVVPSKQILHSDNMEMEPET
METKSVTDYFSKLHMGSLVYSCTSKRKTKMADSEVKAACDGNATVKKHQGAKRAESDDDL
KTKCGTLSTRDSQRISTFNVERTAFRQRWYAAVDDEAADKPSSEIMNGKTFPRVSSLGKT
DTGSKNEVDPEVAEDDTSPLGQGENFLSDMTHVSSAKDLNDSEDADDHSSKVPEAEHSVS
RLCEYHLTKRMSSLQSEGHFSLQSSQCSSVDAGCSTGSSPCATPVESPLCTSDVKHIISD
SSMKGIGYLPADERVAVLPNHGTTYKELHQQSEVVCHRMAMPAIHSAVNAEPLFGTLRDG
CHRIPKIKETTG
Download sequence
Identical sequences K7FP23
ENSPSIP00000009783 ENSPSIP00000009783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]