SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000009787 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000009787
Domain Number 1 Region: 46-172
Classification Level Classification E-value
Superfamily Second domain of FERM 5.76e-32
Family Second domain of FERM 0.002
Further Details:      
 
Domain Number 2 Region: 174-278
Classification Level Classification E-value
Superfamily PH domain-like 6.39e-25
Family Third domain of FERM 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000009787   Gene: ENSPSIG00000008810   Transcript: ENSPSIT00000009835
Sequence length 1065
Comment pep:known_by_projection scaffold:PelSin_1.0:JH208694.1:699748:725934:1 gene:ENSPSIG00000008810 transcript:ENSPSIT00000009835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEQRIEGAGTKLLLLHEQETLAQVTQRPSSHKMRCLFRISFVPRDPIDLLRRDPVAFEY
LYVQSCNDVVQERFGPELKYDIALRLAALQMYIATVTTRQTQKISLKYVEKEWGLETFLP
SAVLQSMKEKNIKKALSHLVKANQNLVPPGKKLSALQAKVHYLKFLSDLRLYGGRVFKAT
LVQGEKRSEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMFTEDENTVRVELHVL
DVKPITLLMESSDAMNLACLTAGYYRLLVDSRRSIFNMANKKNAGNRETGTENRGKHNLH
ASEWNCVPKTTTFMAEGDHEVQITFVDPKQKTSEISEIPMCQKDHRHLYIENTYNSGGLD
QVLTKQDDSTEVGENRSLNQQSSLSPSGVESTKKTQDSPRGAKVSFIFGDHSLDGISPQT
LGYERLLDDSPEVLDKQRAIYISNTNDIKGLELSPDVESIQFATNSVYASINDGKIFGAA
EGIEEPLLHDICYAENTDDAEDEDEVSCEEDIMVGEISRPAILSLSGSSDDIIDLTSLPP
PEGDDNEDDFLLHSLNMAIAAPPPGFRDSSDEEDSQNQTTQYIEDKEQASNLGNDDIPVS
LIDTVPTNTEGKCDKGLDDAVVSTLQALEALAASEEQQTNGNSGVAILRAYSPESSSDSG
NETNSSEMTESSELTTAQRQSENSTRIFLTTSEGYQPLVEEQTEFPIAKNQTGGPLAKSS
QSIAGCQAAELQSKVVPSKQILHSDNMEMEPETMETKSVTDYFSKLHMGSLVYSCTSKRK
TKMADSEVKAACDGNATVKKHQGAKRAESDDDLKTKCGTLSTRDSQRISTFNVERTAFRQ
RWYAAVDDEAADKPSSEIMNGKTFPRVSSLGKTDTGSKNEVDPEVAEDDTSPLGQGENFL
SDMTHVSSAKDLNDSEDADDHSSKVPEAEHSVSRLCEYHLTKRMSSLQSEGHFSLQSSQC
SSVDAGCSTGSSPCATPVESPLCTSDVKHIISDSSMKGIGYLPADERVAVLPNHGTTYKE
LHQQSEVVCHRMAMPAIHSAVNAEPLFGTLRDGCHRIPKIKETTV
Download sequence
Identical sequences K7FP27
ENSPSIP00000009787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]