SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000009912 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000009912
Domain Number 1 Region: 86-191
Classification Level Classification E-value
Superfamily Second domain of FERM 1.31e-32
Family Second domain of FERM 0.0000885
Further Details:      
 
Domain Number 2 Region: 189-291
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-27
Family Third domain of FERM 0.0027
Further Details:      
 
Domain Number 3 Region: 14-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.82e-22
Family First domain of FERM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000009912   Gene: ENSPSIG00000008947   Transcript: ENSPSIT00000009962
Sequence length 561
Comment pep:known_by_projection scaffold:PelSin_1.0:JH211347.1:4054683:4259239:1 gene:ENSPSIG00000008947 transcript:ENSPSIT00000009962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRGECYIRANSIRVAVDKKRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEF
TKSVVKQMRAQPPFTMCFRVKFYPTDPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAA
LLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELN
FLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRIHFIKWNEVTKMKFEGK
TFYLYVSQKEEKKIVLTYFAPTPEACKHLWKCGIENQAFYKLRESTSVSSARHSHQELGG
TKGAWGAELGREGPEGAGGVRPLPPQGHQNGHAGSDQWPVSYHAWSQSPGAPMWRRTRGH
VVLKEESLESLRDSAHSTPVRSASHSDAFLPPVRSSRVDSSERVAIISDEIYSPADSVLP
TPVAEHSLELMLLSRQINGAPCSIEEEKESEANTPTATEADEMRGEFKALCQGVGGTGGT
QATQVNKFVLSVLRLLLVTVGLLFVLLLLLIILTESDLDVAFFRDIRQTPEFEQFHYQYF
CPLRRWFACKVRSVLSLLIDT
Download sequence
Identical sequences K7FPF2
ENSPSIP00000009912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]