SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000010411 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000010411
Domain Number 1 Region: 339-476
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-42
Family C-type lectin domain 0.0000937
Further Details:      
 
Domain Number 2 Region: 202-335
Classification Level Classification E-value
Superfamily C-type lectin-like 1.62e-36
Family C-type lectin domain 0.0004
Further Details:      
 
Domain Number 3 Region: 488-623
Classification Level Classification E-value
Superfamily C-type lectin-like 5.57e-33
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 4 Region: 1075-1202
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-26
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 5 Region: 1216-1349
Classification Level Classification E-value
Superfamily C-type lectin-like 1.03e-25
Family C-type lectin domain 0.0059
Further Details:      
 
Domain Number 6 Region: 767-904
Classification Level Classification E-value
Superfamily C-type lectin-like 4.9e-25
Family C-type lectin domain 0.00079
Further Details:      
 
Domain Number 7 Region: 1-139
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.16e-23
Family Cysteine rich domain 0.00082
Further Details:      
 
Domain Number 8 Region: 139-197
Classification Level Classification E-value
Superfamily Kringle-like 1.23e-20
Family Fibronectin type II module 0.00087
Further Details:      
 
Domain Number 9 Region: 629-759
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-17
Family C-type lectin domain 0.0022
Further Details:      
 
Domain Number 10 Region: 918-1066
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000825
Family C-type lectin domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000010411   Gene: ENSPSIG00000009251   Transcript: ENSPSIT00000010464
Sequence length 1447
Comment pep:known_by_projection scaffold:PelSin_1.0:JH209439.1:3795866:3848184:-1 gene:ENSPSIG00000009251 transcript:ENSPSIT00000010464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSKVFLIYNSRLQGCLETKDALVRISKACNASAPAQKWKWVSRNRLFNLGTMQCLGVSWQ
GSNSTAAGQSLATYECDRESVNMRWNCRNLGEPGPQMCINYLNAKAGNLSLAPAERGDQA
RGGQWSIYNTQEDLCSNPYSEIYTIQGNSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWC
ATTQDYGKDERWGFCPIKSNDCETFWDKDHLTNSCYQFNFQSTLSWREAWSSCEQQGANL
LSITEIHEQTYINGLLTGYSSTLWIGLNDLDMNGGWQWSDNSPLKYLNWESDQPDNPSEE
NCGVIRTESSGGWQNRDCSIALPYVCKKKPNATSDPFTTDSWSEVKVDCEPSWQPFQSSC
YRLVGEKKSWQDAKKTCLRGGGDLVSIHTLSELEFVTKHIKGFEDVEELWIGLNDLKLQM
NFEWSDGTPVRFTYWHPFEPNNFRDSMEDCVTIWGPEGRWNDSPCNQTLPSICKKPGRVS
QRGEEEDDHGCRKGWKWHSPSCYWLGEDRVTYSDARKMCVDFGATLVTITNRFEQAYVSS
LIYGWDSEYFWTALQDINETGSFRWLSGDEVMYTHWNRNQPGYSRGGCVALATGSSMGLW
DVKNCNTFKAKYICRQNLGTPVNPELPAPYPTPSLTGSCPQGWSSDPKLRHCYKLHAKGK
RRQECFPLPPLHQLLVVSSSESEPEIHEQHWFWIGLNRRDPGAERSWQWSDGLGFFYHNF
DRSNHDDDDIRNCAVLDLASLQWMPMQCDSQLDWICKLPKALMSKPSETPPELSSKEWLP
YQDAEYKFFEHHSTWVQAQRICTWFQAELVSVHSQAELDFLGQSLKKAGNRLPSTLVCGF
PAREPSRVAVMWSDGSLLNFISWAPGKPRPISKEKKCVYVTASREDWGDQKCLTALPYIC
KRSNTTALKPSLPPVPAPVPGGCAWGWIPFLNKCFSIKGHDKAEQVKWQEAKQACESQGA
VLATISNHLEQETEGTEGVCQVSAPALTARREGQESFHPQGWARGRPRVRTNPPPTPGTR
GGWLSWAPTNCAVVWHGSPPHFTGRWDDRNCLEEKHGYICQRSIDPALSSRTSSPPSPTS
PLSYLNSTYRILQKPLKWQEAVLLCETRNATLASVLDPYTQAYLSLAISSLRAPLWIGLA
KEEGGRSYSWVTEESLSYANWQDGEPQQVTGCSYMDVDGTWRTAGCDTKLQGAVCRVNSG
SPPSHKWSYNGSCPKSVEDSSWIPFRDHCYAFHMEVTLGQKDAMRRCQKAGGTVLSIQDE
TENIFVWEHLQAYESQSKGAWLGMAFNPKGGTLVWHDNTAMNYSNWGQHDTGPSMLSQNS
CYWIQGSTGVWHLGSCSNVTMGVICKIPRGEGLAPGYQVLSGRAGSFMGIFLSPSALPEN
TTAIAVVVLSALALCALIALTVYLYKRRRSAERGAFESARYSRTTSNPSESAEKNILVSD
MEMNEQQ
Download sequence
Identical sequences K7FQV1
ENSPSIP00000010411 ENSPSIP00000010411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]