SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000011283 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000011283
Domain Number 1 Region: 475-719
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.13e-64
Family Nuclear receptor ligand-binding domain 0.0000000003
Further Details:      
 
Domain Number 2 Region: 358-435
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.18e-25
Family Nuclear receptor 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000011283   Gene: ENSPSIG00000010176   Transcript: ENSPSIT00000011339
Sequence length 721
Comment pep:known_by_projection scaffold:PelSin_1.0:JH209317.1:1622400:1757141:-1 gene:ENSPSIG00000010176 transcript:ENSPSIT00000011339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVQVGLNSVHSRPGGRTFRGAFQTLFQSVREAFQSPGAGLLGEEPGTNPQPSSSVQCPP
GAHLPEDESPAVPPSSTLSLMGSTFHGCSGDFKDILSEAGTLQLLPPETQTRGSRGDEAS
ATKEDFLGDNAKELCKAVSASMGLGVEALETPSELLPREDCMFAQPSGHSRGAAGTQLGD
KQGTSPASFKGRSATGSSHGPGENALAVEVPPTLSLYKSSPGLEEPVALQGRDYYNFQLA
LAPHARIKLENPLDYGPGSSWAAQCRAPAWHSFFTDEGQLYSRCGRNQGPPGQEGSDFPS
DMWYPGGMVSRMPYAAASGCIKSELTPWMEGYAGAFGEIRLEAGRDHVLPIDYYFPPQKT
CLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRK
CYEAGMTLGARKLKKLGNLKMQEDGEGANSSSPTEEQTPKMVMTCIDGFECQPIFLNVLE
AIEPIVVCAGHDNNQPDSFAALLTSLNELGERQLVHVVKWAKALPGFRNLHVDDQMALIQ
YSWMGLMIFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQ
ITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIISCKRKNPTSCSRRFYQ
LTKLLDTVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHM
Q
Download sequence
Identical sequences K7FTC3
ENSPSIP00000011283 ENSPSIP00000011283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]