SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000011499 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000011499
Domain Number 1 Region: 164-446
Classification Level Classification E-value
Superfamily Kelch motif 7.45e-47
Family Kelch motif 0.005
Further Details:      
 
Domain Number 2 Region: 581-727
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-23
Family C-type lectin domain 0.003
Further Details:      
 
Domain Number 3 Region: 861-907
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000385
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 4 Region: 13-48
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000837
Family Spermadhesin, CUB domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000011499   Gene: ENSPSIG00000010130   Transcript: ENSPSIT00000011556
Sequence length 1227
Comment pep:known_by_projection scaffold:PelSin_1.0:JH224676.1:2507462:2658373:1 gene:ENSPSIG00000010130 transcript:ENSPSIT00000011556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGLIVPERDGNETVPEVVTTSGYVLLHFFSDAAYNLTGFNITYHFDMCPNNCSGRGECKL
GNGSNTVQCECSEHWKGEACDIPYCTDDCGYPERGQCTSNGTKGCSCYSNWQGPGCAIPV
PANQSFWTREEHSSPKLPRASHKAVVNGHVMWVVGGYRFNHSDSHMVLAYDLVSEEWLPL
NNTVNLVQIRYGHSLALHENKIYMYGGKIDSTGNVTNQLWVFHIHNESWVQVTPKAKEQY
AVVGHSAHIVTLEDGSIVMLVIFGHCPLYGYVSNMQEYNLATNTWNIVRTSGALVQGGYG
HSSVYDPNSKSIYIHGGYKAFSANKYRLADDLYKYEVETQMWTILKDSRFFRYLHTAVIM
SGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIACDQWSVLPRPDLHHDVNRFGHSAVLS
NSTMYVFGGFNSLLLSDILRYTPESCEAYGNETSCFKAGPGIRCVWNTTFSQCVPWEAAT
VEQQQKVFEECPSKPVADDEKCRQITDCYSCTANTNSCQWCTDQCILKHSNCTEDQVPII
EYDKCPKDNPAYYCNKRTSCKSCAMDQNCQWEPRNQECIALPENICGANWHLVGNSCLKI
ASTKESYDNAKLTCRNANALLASLTTQKKVEFVLKELQKMQSVVSVTPKTLTPWVGLRKI
NVSYWCWEDMSPFTNTSLQWLPGEPSGAGFCGYLAEPYQQGLKAATCINQVNGSVCERPA
NHSAKQCRTPCALRMMCGECTSGSSECMWCSNMKQCVDSNAYVASFPYGQCLEWYTMSSC
PPENCSGYCTCGHCLEQPGCGWCTDPSNTGKGKCMEGSYRGPVKIPSPSTTGKHYMEPIL
NVSMCPAENKYNWSFIQCPACQCNGHSKCVNESICEKCENLTTGKHCETCISGYYGDPTN
GGTCQSCKCNGHASICNTNTGKCFCTTKGIKGDECQLCEVENRYQGNPLKGTCYYTLLID
YQFTFSLSQEDDRYYTAINFVATPEEQNRDLDMFINASKNFNLNITWSTSFAAGTQAGEE
IPVISKSNIKEYKDSFSNEKFDFRNNPNITFFVYVSNFTWPIKIQIAFSQHSNFMDLVQF
FVTFFSCFLSLLLVAAVVWKIKQSCWASRRREQLLREMQQMASRPFASINVALETDEEPP
DLIGGSIKTVPKPIALEPCFGNRAAVLSVFVRLPRGLGGIPPPGQSGLAVASALVDVSQQ
MPIAYKEKSGAIRNRKQQPPAQPGTCI
Download sequence
Identical sequences K7FTY9
ENSPSIP00000011499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]