SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000011788 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000011788
Domain Number 1 Region: 70-118
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000275
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 2 Region: 32-71
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000379
Family Somatomedin B domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000011788   Gene: ENSPSIG00000010628   Transcript: ENSPSIT00000011845
Sequence length 257
Comment pep:novel scaffold:PelSin_1.0:JH211368.1:369573:395660:-1 gene:ENSPSIG00000010628 transcript:ENSPSIT00000011845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WVAAALLLLLRAPGAETGWAEVGRCCRGRDLACVSTGWGPDRSHGACYCDQACARTMDCC
HDYPQACPEVPCAVSEWSNWSSCAEPCQATYRVRRRYVVQEPRNGGETCPPLEEKAGCVE
YWNQQGAECKQSLIPALITTGGYGKARKKRAASKENEGAGYCVEFQLMAITEGCLQGNSS
YTQWMRYLSKGHTVCVECQHPALDSKSLHCSGDGSGSKKNQLLHWQAMGNPWCRGTWRRV
RQLDTCSCPSVHSFLFI
Download sequence
Identical sequences K7FUS8
ENSPSIP00000011788 ENSPSIP00000011788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]