SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000011902 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000011902
Domain Number 1 Region: 373-759
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.26e-124
Family Oxysterol-binding protein 0.0000412
Further Details:      
 
Domain Number 2 Region: 119-239
Classification Level Classification E-value
Superfamily PH domain-like 2.06e-23
Family Pleckstrin-homology domain (PH domain) 0.000000708
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000011902   Gene: ENSPSIG00000010502   Transcript: ENSPSIT00000011959
Sequence length 864
Comment pep:known_by_projection scaffold:PelSin_1.0:JH209040.1:326634:420015:1 gene:ENSPSIG00000010502 transcript:ENSPSIT00000011959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVTNSDEPHLLTPGKMSQRQGKEAHLTPTKDLLQPALSPGTVHSHGFDRGKDDVSQSKED
SAHSMSKSKSESKLYNGSDKDISSTANKLTKKESLKVQKKNYREEKKRATKELLSTITDP
SVIVMADWLKIRGTLKSWTKLWCVLKPGVLLIYKNPQNGQWVGTVLLNACELIERPSKKD
GFCFKLFHPLEQSIWAVKGPKGEAVGSITQPLPSSYLIIRAASESDGRCWMDALELALKC
SGLLKRTMIREGKEHDLNSSADSTHVSLYGLLRATNLPNTETFPLNYSEIERHHFKDQDV
YSDKSDKENDHDHDESDNDGLGKSEESDTDTSERQDDSYIDQEPVDFIRETTYMEQVHEE
LGEAGEASQTETVSEENKSLIWMLLKQVRPGMDLSKVVLPTFILEPRSFLDKLSDYYYHA
DFLSEAALEENAYNRMKKVVKWYLSGFYKKPKGLKKPYNPILGETFRCMWIHPRTNSKTF
YIAEQVSHHPPVSAFYVSNRKDGFCLSGSILAKSKFYGNSLSAILDGEGRLMFLNRGEDY
IMTMPYAHCKGILYGTMTLELGGIVNIACEKTGYSATIEFRLKPFLGNNDSVNQISGKIK
LGKEVLATLEGHWDSEIIISDKKTDVSETFWNPTSEIKQRRLTRYTVKFDEQDDFESEKL
WQQVTRAINNKDQTEATNEKCILEDAQRKAAKERKLKGEGWTCKLFEQDLITGDWHYKYA
ETRPWDPLNDMIQFEKDGAIQTKVRHRTPMVSVPKIKRKPTSQSKKECGFSSPEPDNQDS
SGSEAQLLKHNTRIRKKGIDLGELQSAIESIKETQEDIKRDIMALRNRVTSNSPPQENNF
LQFKHYVFIFLMVLLQLIINFLFK
Download sequence
Identical sequences K7FV42
ENSPSIP00000011902 ENSPSIP00000011902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]