SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000011986 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000011986
Domain Number 1 Region: 398-541
Classification Level Classification E-value
Superfamily PH domain-like 2.49e-41
Family Third domain of FERM 0.0000103
Further Details:      
 
Domain Number 2 Region: 291-399
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-33
Family Second domain of FERM 0.00000384
Further Details:      
 
Domain Number 3 Region: 211-290
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.72e-26
Family First domain of FERM 0.0000921
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000011986   Gene: ENSPSIG00000010546   Transcript: ENSPSIT00000012044
Sequence length 992
Comment pep:known_by_projection scaffold:PelSin_1.0:JH207526.1:1474814:1633449:-1 gene:ENSPSIG00000010546 transcript:ENSPSIT00000012044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEVGPETEVKKESEQLEADAAKNKQDEATENQENQKSEKTVSEEAQGSPSPALGTQSS
PSSQKKEKEPSEGKGISRFIPPWLKKQKSYSLVEPKDEAKKKPVEEGETVEERECQLPGE
VVQPKGSVEEATIESEREAKAEDKEEKHSVSSAETQPAKEDNKEIEVEKVADEQEEKQKA
EENRETKEVQTAEINMEKVPQKAPKKIKTVQCKVMLLDGTEFSCDIEKRAKGQVLFDKVC
EQLNLLEKDYFGLLFQDNSDQKNWLDSSKEIKRQIRSLPWLFTFNVKFYPPDPSQLTEDI
TRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDPEENNNDYISEFQFAPNQT
KEMEEKVVELHKTHSDSRGLTPAQADSHFLENAKRLSMYGVDLHHAKDSEGVDIMLGVCA
NGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPTEQEQFESTIGFKLPNHRAAKRLW
KVCVEHHTFYRLISPEQPPKAKFLTLGSKFRYSGRTQAQTRQASNLIDRPAPYFERTSSK
RVSRSLDGAPVGIIDQTTVGPAGDMVFDGEAVGQTKLRDGEGRDEDGSPTKISQLELTQD
EKNNSLRVDGGNIYVRHSNLMLEDLDKTQDDLLKHQASISELKRNFMESTPEPRPNEWEK
RRITPLSLQTQGSSHETLNVVEEKKQAEVGIEETVVIEELNRGKMQAVTDAGETRKVEHL
SKKDSSSLSSDSSSSSESEDEVVGEYQPHYRVAKDTIREEQEENEDAKGKEERATKTIQS
EETVQEGSKIKVTVEHNQITAKALAQENAVAIKVGEKNVMEEEKQDLRAEDEQLRINGDV
SHVDIDVVPEIICCSEPPVVKTEMVTISDATQRTEISTKEVPIVQTETKTITYESPQFDG
SAGGDAGVLLSAQTITSESVSTTTTTHITKTVKGGVSETRIEKRIVITGDADIDHDQALA
QAIKEAKEQHPDMSVTRVVVHKETELAEEGEE
Download sequence
Identical sequences K7FVC6
ENSPSIP00000011986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]