SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000012317 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000012317
Domain Number 1 Region: 361-497
Classification Level Classification E-value
Superfamily C-type lectin-like 7.52e-34
Family C-type lectin domain 0.00055
Further Details:      
 
Domain Number 2 Region: 1248-1378
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-30
Family C-type lectin domain 0.00093
Further Details:      
 
Domain Number 3 Region: 217-351
Classification Level Classification E-value
Superfamily C-type lectin-like 9.11e-29
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 4 Region: 1113-1232
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-28
Family C-type lectin domain 0.0021
Further Details:      
 
Domain Number 5 Region: 660-808
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-27
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 6 Region: 807-936
Classification Level Classification E-value
Superfamily C-type lectin-like 5.77e-27
Family C-type lectin domain 0.00091
Further Details:      
 
Domain Number 7 Region: 952-1097
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-26
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 8 Region: 510-642
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-24
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 9 Region: 38-163
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.53e-20
Family Cysteine rich domain 0.0064
Further Details:      
 
Domain Number 10 Region: 165-219
Classification Level Classification E-value
Superfamily Kringle-like 1.11e-17
Family Fibronectin type II module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000012317   Gene: ENSPSIG00000011109   Transcript: ENSPSIT00000012376
Sequence length 1457
Comment pep:known_by_projection scaffold:PelSin_1.0:JH205405.1:3189150:3277558:1 gene:ENSPSIG00000011109 transcript:ENSPSIT00000012376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVQIQLLACAMLLVCYSVAEDDAALSRDQVPYFLNKGIFIIQSEHLNLCIKADTFGLV
LEDCNQLSKYMLWKWVSKRHLFNIGRSTCLGLNISNEEQPLSLLECDSTQHSLWWNCNGK
LLVGASEYKLAAENGKHIIAKRITNHEWKQYMSHDEDLCERPFQETYTLLGNSLGLPCIF
PFKYKKKWYYECIRESREFYWCATTSQYEQDEKWGFCPNAEPGCDIFWEKNPDTHICYQF
NLFSILSWNEARIACQTQGGDLLSITDMTEQKYISEKLSTKEILLWTGLNRLDECAGWQW
SDGAPLAFVNWRSNLTDSPPEENHCMVFNSKVQYDWQSYKCESRLPYGCKKYGSSAEYET
FDSWKYHPTNCNPGWYSYNLNCYKLHKEEKSWNEAHLSCQTDNSSLISITSLAELELLIN
FLEQENVTETWIGLNSNKNLVIFQWSDGSLVTFTNWHKQEPNIFQKTSQLCVSAEGSAGR
WKVKNCEDKYFYICKREGWFENVTSKEESGCQEGWERHGGYCYKIDNTPRSFEHASSGYY
CPPSLVTVTNRFEQAFINSMIRRMVETDNTYFWIALQDLNNTGEYSWLTTEGKNQPVSYT
NWNKYQPSHSGGCVVIRRGQPLGYWEVKNCRSFKAMSLCKQKMDSYEENQPNFEEPSDAC
YPGWESDSNLLNCYKVFHYEKVLKKRTWDEAEELCQDLGAHLASFTHVYEEDFLNTFLNK
IFDRVDERQFWIGFNKRNPLSGGTWVWSDGTPVVSAFLQNIYVEDDSRNCAAYQVNRTVL
PLHCNGKREWICKIPKGVKPKSPIWYIHEPPLSYYQGAEYLFHISASEWAIFEFICGWLR
GEIVTIKSSDEQEFIHSKIKQLSKSDLRWWIGLHSEVPSDGFRWRDGSPVVYENWNEERE
RSVRTQGERCGFISSHTGLWGDENCTTSLPSICKRKTVWKIEREILRGQNHQGVCPKGWL
YFGFKCFLIQIPKNPDHLRNWYSAQTFCSEQKGSLASIENEAEQAFITMNLYGQRTSVWI
GLQSDDYDKWVNEQPKVYSNWSPVEAAHGQEYDGVNIQEQVSLCTLVSNNPNFHFTGKWY
LESCEKNYGFICQKSQDMSSHAIDASEMYPVPDILEYGSRTYKLIRGNMTWFAALKTCLT
NGTELVSITDQYHQAFLTVIVNRLGYAHWIGLSTSDSGLNFEWSDGTKSLFTFWGDEESQ
SLGSCVYIDINGQWESANCERLLQGAICHVPTEKKLIESRGLCSEENVAWIKFKSNCYSF
STVFESTSFDMANVFCKKQGSHLLTIKDEDENVFILEELHHFGSSVQKIWLNIQFVADNN
TVAWRDGSPLNYSNWGIREPDLDNLKGNFCIALRTTDGAWQLSPCREKMGFVCKMDTDIF
ETVQTVKASYHQIIALAVMVTLVMVAAISTFLWCLYRQNGSLFSRIRWFRNPYYSQTNSD
SLALEESNLISDFESEN
Download sequence
Identical sequences K7FWA7
ENSPSIP00000012317 XP_006111711.1.96668 ENSPSIP00000012317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]