SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000012413 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000012413
Domain Number 1 Region: 216-479
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.04e-83
Family Nuclear receptor ligand-binding domain 0.000000000286
Further Details:      
 
Domain Number 2 Region: 112-196
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.42e-28
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000012413   Gene: ENSPSIG00000011100   Transcript: ENSPSIT00000012474
Sequence length 481
Comment pep:known_by_projection scaffold:PelSin_1.0:JH207284.1:412396:463136:-1 gene:ENSPSIG00000011100 transcript:ENSPSIT00000012474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLSGITMVDTEMPFWPINFGISPVDLSAMEDHSHSFDIKPFTTVDFSSISSPHYEDISIA
RTDQTTGDTINLLKTLPYAGAIKMEPPSPPYFSEKVQLYSKPQEETSNSLMAIECRVCGD
KASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMS
HNAIRFGRMPQAEKEKLLAEICSDIDQLNPESADLRALAKNLYDSYIKSFPLTKAKARAI
LTGKTTDKSPFVIYDMNSLMMGEDKINCKHVTPLQEQNKEVAIRIFQRCQFRSVEAVQEI
TEFAKSIPGFVNLDLNDQVTLLKYGVHEIIYTLLASLMNKDGVLISNGQGFMTREFLKSL
RKPFCDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQA
LELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQIIKKTETDMNLHPLLQEIYKDL
Y
Download sequence
Identical sequences K7FWK3
ENSPSIP00000012413 ENSPSIP00000012413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]