SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000012600 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000012600
Domain Number 1 Region: 208-447
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-70
Family Nuclear receptor ligand-binding domain 0.000000000858
Further Details:      
 
Domain Number 2 Region: 6-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.75e-32
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000012600   Gene: ENSPSIG00000011314   Transcript: ENSPSIT00000012661
Sequence length 459
Comment pep:known_by_projection scaffold:PelSin_1.0:JH212794.1:857868:888453:1 gene:ENSPSIG00000011314 transcript:ENSPSIT00000012661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNR
CQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAEPLTP
TYSITTNGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPI
CDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHMETCQYLREELQQITWQTFL
QEEIENYQNKQREVMWQLCAVKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVV
FIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEIALFS
AFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRH
TEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
Download sequence
Identical sequences K7FX40
ENSPSIP00000012600 ENSPSIP00000012600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]