SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000012708 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000012708
Domain Number 1 Region: 14-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.52e-75
Family BAR domain 0.00000000284
Further Details:      
 
Domain Number 2 Region: 280-348
Classification Level Classification E-value
Superfamily SH3-domain 1.14e-22
Family SH3-domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000012708   Gene: ENSPSIG00000011372   Transcript: ENSPSIT00000012769
Sequence length 352
Comment pep:known_by_projection scaffold:PelSin_1.0:JH210647.1:2233862:2272284:-1 gene:ENSPSIG00000011372 transcript:ENSPSIT00000012769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNEDLPKPRHQSSQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVVEIMTKTVEYLQP
NPASRAKLNMINTMSKIRGQEKGPGYPQAEALLADAMQKFGRELGDDCNFGPALGDVGEA
MRDLSEVKDSLDIEVKQNFIDPLQNLHDKDLREIQHHLKKMEGRRLDFDYKKKRQGRLPD
DELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLKYHRQATEILQQVTVKL
EERIRDASSQPRREYLPKPRMSLEFSSGENTQYNGGISQTGTPKPTGVPMDQPCCRALYD
FDPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVDILVPLPH
Download sequence
Identical sequences K7FXE8
ENSPSIP00000012708 ENSPSIP00000012708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]