SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000013390 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000013390
Domain Number 1 Region: 186-457
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.55e-83
Family Nuclear receptor ligand-binding domain 0.00000000111
Further Details:      
 
Domain Number 2 Region: 133-214
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.59e-31
Family Nuclear receptor 0.00000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000013390   Gene: ENSPSIG00000011977   Transcript: ENSPSIT00000013453
Sequence length 463
Comment pep:known_by_projection scaffold:PelSin_1.0:JH212641.1:299690:595702:1 gene:ENSPSIG00000011977 transcript:ENSPSIT00000013453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKHFLPLDFSTQVNSTSLNSPSGRGPMAAPSLHPSIGPGIGSSGQLHSPISTLSSPIN
GMGPPFSVISSPMGPHSMSVPSTPTLGFGTGSPQLSSPMNPVSSTEDIKPPLGLNGVLKV
PAHPSGTMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLI
DKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKILEAE
LAVEPKTETYIEANMGLTPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVI
LLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRD
MQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPDQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
Download sequence
Identical sequences K7FZD0
ENSPSIP00000013390 XP_006136674.1.96668 ENSPSIP00000013390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]