SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000013667 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000013667
Domain Number 1 Region: 151-417
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-58
Family Nuclear receptor ligand-binding domain 0.0000000297
Further Details:      
 
Domain Number 2 Region: 79-156
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.36e-28
Family Nuclear receptor 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000013667   Gene: ENSPSIG00000012281   Transcript: ENSPSIT00000013731
Sequence length 419
Comment pep:known_by_projection scaffold:PelSin_1.0:JH205821.1:908837:937074:1 gene:ENSPSIG00000012281 transcript:ENSPSIT00000013731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCYDPAALSLPLGSDRPTASQATMENHPSGLPLAKRAAALTFSPLGLNAATSSMLGESSS
SSSGLPSPPSRSSSSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANK
NCPVDKRRRNRCQYCRFQKCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPP
SPPISMMNALVRALTDSTPRELDYSRYCSTDQAAAGTDAEHVQQFYNLLTASIDISRGWA
EKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSDTAEDKFVFCNGLVLHRLQCLRGFGE
WLESIKDFSLNLQSLNLDIPALACLSALSMITERHGLKEPKKVEELCNKITSSLKDHLAF
SCQNKGQPLESAEPKVLGVLADLRSLCTLGLQRIFYLKLEDLVPPPSIIDKLFLDTLPF
Download sequence
Identical sequences K7G057
ENSPSIP00000013667 ENSPSIP00000013667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]