SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000014138 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000014138
Domain Number 1 Region: 128-376
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-69
Family Nuclear receptor ligand-binding domain 0.00000000346
Further Details:      
 
Domain Number 2 Region: 59-142
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-30
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000014138   Gene: ENSPSIG00000012689   Transcript: ENSPSIT00000014204
Sequence length 466
Comment pep:known_by_projection scaffold:PelSin_1.0:JH211368.1:3057235:3106685:1 gene:ENSPSIG00000012689 transcript:ENSPSIT00000014204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMRLSKALIDMEMADYSAALDPAYTTLEFENMQVLAMGNDTPPSDTTNLSATNSIGMSA
LCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFNRQCVVDKDKRNQCRYCRLK
KCFRAGMKKEAVQNERDRISTRRSSYEDSSLPSINVLLQAEVLAQQISSPISVINGDIRG
KTIANITDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGVAKRSMV
FKDILLLGNDHIIPRNCPELVEVSRVAIRILDELVLPFQELQIDDNEYACLKAIVFFDPD
AKGLSDPTKIKRMRYQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFV
KLFGMAKIDNLLQEMLLGGSSSETPHAHHPLHPHLIQENLGTNVIVANTMPAQLHNGQMS
TPETPQPSPPAGSGPEQYKLLPGAIATVAKQPTSIPQPTITKQEVI
Download sequence
Identical sequences K7G1H7
XP_006132303.1.96668 ENSPSIP00000014138 ENSPSIP00000014138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]