SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000015172 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000015172
Domain Number 1 Region: 211-352
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-41
Family Third domain of FERM 0.00000251
Further Details:      
 
Domain Number 2 Region: 102-210
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-37
Family Second domain of FERM 0.00000218
Further Details:      
 
Domain Number 3 Region: 15-99
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.16e-24
Family First domain of FERM 0.000016
Further Details:      
 
Domain Number 4 Region: 502-552
Classification Level Classification E-value
Superfamily Moesin tail domain 0.00000000105
Family Moesin tail domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000015172   Gene: ENSPSIG00000013457   Transcript: ENSPSIT00000015243
Sequence length 553
Comment pep:known_by_projection scaffold:PelSin_1.0:JH205825.1:969207:1006687:1 gene:ENSPSIG00000013457 transcript:ENSPSIT00000015243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INKKMSIRGLKKKQPKTFKVKVITMDAEMEFSCEMKWKGKDLFDLVCRALGLRETWFFGL
QYTIKGMSTWLKMDKKVLDQEIPKEDPVSFRFLAKFYPEKVEEELLQEITQHLFFLQVKK
QILDEEIYCSPEATVLLASYAVQAKYGDYDPNFHEPGFLAQDELLPKRVLRQYQMTADMW
EEKISAWYAEHRGIARDEAEMNYLKIAQDLEMYGVNYFPIANKNDTDLLLGVDAKGIHVY
SRNNRLSPNKSFEWSGIRNISYSEKELTIKPLDKKAEVFKFFSSQLKVNKLILQLCIGNH
DLFMRRRKVDSIEIQQMKAQAREEKARKKMETQRLAREKQLREEAERAKEELERRLFQLE
DEARQANEALLRSQETAELLAEKAQIAEEEAKLLAQNAAEAEQERQRLEITALKSKEEKR
LMEQKMRETELIAVKLVKESDRRAKEAEHLKQDLHEAREAERKAKQKLLDVTRLNYPHVA
QYSSHSPADTRDVNLDKGSGKMDLKDVDLKRLSFEIEKERLDYLEKSKKFEDRLKELKSE
IHALKLEEKQTGL
Download sequence
Identical sequences K7G4G1
ENSPSIP00000015172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]