SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000015184 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000015184
Domain Number 1 Region: 207-349
Classification Level Classification E-value
Superfamily PH domain-like 3.93e-40
Family Third domain of FERM 0.00000254
Further Details:      
 
Domain Number 2 Region: 98-206
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-37
Family Second domain of FERM 0.00000218
Further Details:      
 
Domain Number 3 Region: 11-95
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.45e-24
Family First domain of FERM 0.000016
Further Details:      
 
Domain Number 4 Region: 499-550
Classification Level Classification E-value
Superfamily Moesin tail domain 0.000000000288
Family Moesin tail domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000015184   Gene: ENSPSIG00000013457   Transcript: ENSPSIT00000015255
Sequence length 644
Comment pep:known_by_projection scaffold:PelSin_1.0:JH205825.1:969378:1015449:1 gene:ENSPSIG00000013457 transcript:ENSPSIT00000015255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIRGLKKKQPKTFKVKVITMDAEMEFSCEMKWKGKDLFDLVCRALGLRETWFFGLQYTI
KGMSTWLKMDKKVLDQEIPKEDPVSFRFLAKFYPEKVEEELLQEITQHLFFLQVKKQILD
EEIYCSPEATVLLASYAVQAKYGDYDPNFHEPGFLAQDELLPKRVLRQYQMTADMWEEKI
SAWYAEHRGIARDEAEMNYLKIAQDLEMYGVNYFPIAQNKNDTDLLLGVDAKGIHVYSRN
NRLSPNKSFEWSGIRNISYSEKELTIKPLDKKAEVFKFFSSQLKVNKLILQLCIGNHDLF
MRRRKVDSIEIQQMKAQAREEKARKKMETQRLAREKQLREEAERAKEELERRLFQLEDEA
RQANEALLRSQETAELLAEKAQIAEEEAKLLAQNAAEAEQERQRLEITALKSKEEKRLME
QKMRETELIAVKLVKESDRRAKEAEHLKQDLHEAREAERKAKQKLLDVTRLNYPHVAQYS
SHSPADTRDVNLDKGSGKMDLKDVDLKRLSFEIEKERLDYLEKSKKFEDRLKELKSEIHA
LKLEEKQTGLYSHWNEVLGSLGNAPSWMKSFEAADLLDINLRKAFPAYPLTATSSWPCTN
KSQQAVPVEKSAFQTNALVASSVGTGSRKQMIKVQQHDSDVIYI
Download sequence
Identical sequences K7G4H3
ENSPSIP00000015184 ENSPSIP00000015184 XP_006113168.1.96668 XP_006113169.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]