SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000015433 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000015433
Domain Number 1 Region: 347-695
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.53e-33
Family Hect, E3 ligase catalytic domain 0.01
Further Details:      
 
Domain Number 2 Region: 210-291
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.06e-27
Family PHD domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000015433   Gene: ENSPSIG00000013682   Transcript: ENSPSIT00000015505
Sequence length 699
Comment pep:known_by_projection scaffold:PelSin_1.0:JH206952.1:986193:1020923:-1 gene:ENSPSIG00000013682 transcript:ENSPSIT00000015505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNENTLCCFQSPACVLCQQTDDCPEKYGEKRTYKEYNLTVHYYCLLMSSGIWQRGEEDEG
VHGFLINDIRKEVTRAAKLTCNICKKKGASIGCVAPKCKRSYHFPCGVQRECIFQFMENF
GSYCWEHRPVQKLPSGESRGSSQCTICLEFVERIPLYNVLKSPCCKNAWFHRDCLQYQAL
SAGIFFFRCTVCNNKDKFQNEMLRMGIHIPEKDASWELEENAYQDLLQRYQHCDARTCLC
KNGRDYSKPDSKWEIKRCQCCGSCGTHLACSPMQSWEENWECMECRSIFAKSGYYQNQKK
RSLTNSEKIDVTGRLLEEPSPKCPRQSPGSQHSFHLRQLRIQKREASNILRELKSQINTK
TTRLNINRDDIWSSALKGFRGRNFNPANTMEIKFTNCKDKTETYTFHGSKHEFFQLLMLH
LKISSLFEGSSSKNLSLDSQAIKENLYYEAGKMIAVSLVHGGPPPGFFSKTLFNCLAYGP
ENVKPTEEDVADSDVAQTINMIKSSRTLAHLQSTISDCYEYLTVTGCLRPMTTLSDKDML
VNDILIYHVIKRVLSPFESFRQGLKTLGVLEKLQSHPDAFSSILCHKPERLSAKILGDLF
TIHCVSNLNREKGVDFWMGYLQDVEGGESAATLEDILVFATGTSSIPPIGFEPEPSVEFM
YIKYPVGNRQPNCLQLPITKTYEQFKNKMDFAISSTLRL
Download sequence
Identical sequences K7G572
ENSPSIP00000015433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]