SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000015485 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000015485
Domain Number 1 Region: 143-397
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.64e-69
Family Nuclear receptor ligand-binding domain 0.00000664
Further Details:      
 
Domain Number 2 Region: 73-155
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.6e-31
Family Nuclear receptor 0.0000838
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000015485   Gene: ENSPSIG00000013773   Transcript: ENSPSIT00000015558
Sequence length 411
Comment pep:known_by_projection scaffold:PelSin_1.0:JH211369.1:257460:274387:-1 gene:ENSPSIG00000013773 transcript:ENSPSIT00000015558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVAGGWGDPNGDTNGVDKGYPRTSEEDSVSPQGGASDPEPGDEDKPGIQVDCTVCGDK
SSAEHPQEPELHLQVDCTVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQ
IDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPPSHASTSPTAMPSGEYFNGQPVSELIS
QLLRAEPYPAARYGSQYAQQGSVMGIDNICELAARLLFSTVEWARNIPFFPELPVSDQVA
LLRLSWSELFVLNAAQSALPLHMAPLLAAAGFHAAPMSADRVVSFMDQIRIFQDQVEKLN
RLQVDSAEYSCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRL
LLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ
Download sequence
Identical sequences K7G5C4
ENSPSIP00000015485 ENSPSIP00000015485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]