SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000016016 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000016016
Domain Number 1 Region: 248-425
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.37e-33
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.072
Further Details:      
 
Domain Number 2 Region: 109-191
Classification Level Classification E-value
Superfamily WWE domain 0.000000000000209
Family WWE domain 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000016016
Domain Number - Region: 12-35
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.012
Family CCCH zinc finger 0.0072
Further Details:      
 
Domain Number - Region: 30-105
Classification Level Classification E-value
Superfamily WWE domain 0.0471
Family WWE domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000016016   Gene: ENSPSIG00000014291   Transcript: ENSPSIT00000016092
Sequence length 433
Comment pep:novel scaffold:PelSin_1.0:JH211928.1:739782:745924:-1 gene:ENSPSIG00000014291 transcript:ENSPSIT00000016092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKIQFHIHQAKGIMICDQFLLGLCQEGETCQCHHTRYPYHWQVMRKKKGVWQSVSESAQH
HLEKLYSIINHSLVTLVEKDGSKGKVNLNTMELLSFGPYGDIRRLSNTHDPLQNPHLHTE
WHVYWLDETNWKEYEEPISQEIINAFESGLQNYSFSCEDQQYALDLKNLIQINLTTEQKL
SIQRRPAYHTPIYMVPHLRTLPSGFRGHLNPHAANIPGEDPTDGYYGPYPASWISCPSEG
PIYVQREIAPSEAVYRTVYTLFHKSLSEDTFLVLGIYRIRQQYLWQKYSSQKEIMSRGLS
TEETKQLEQHLFHGTSAESKNAICQMGFDPRLSGQHLAAFGKGSYFAKNSQYANGFCSAC
KAGLRYMFLAKVLVGKSAVGNADYCEPPVISSSGPPFDSCVDSTSSIYVIFNSSQSYPYF
LIRYKLLSDPVML
Download sequence
Identical sequences K7G6V5
ENSPSIP00000016016 ENSPSIP00000016016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]