SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000016684 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000016684
Domain Number 1 Region: 247-455
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.05e-64
Family Nuclear receptor ligand-binding domain 0.0000311
Further Details:      
 
Domain Number 2 Region: 2-65
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000112
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000016684   Gene: ENSPSIG00000014806   Transcript: ENSPSIT00000016760
Sequence length 458
Comment pep:known_by_projection scaffold:PelSin_1.0:JH224667.1:133487:145063:1 gene:ENSPSIG00000014806 transcript:ENSPSIT00000016760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGFFRRSIQQNISYKMCVKNENCMIMRMNRNRCQHCRFKKCLAVGMSRDAVRFGRIPKRE
KQRLLDEMQSYMNSLGEAPMEDQAPAVGDTVRGGGIAGPAPATPVTHPFLFPAQRRQGWK
STPRAPPSPDAQEEEAIGAISRAYHDIFVSGQDRLGTTLTSSSATAMPAGRTSRPTCASP
ATAPAPMRSPPTWTTGPAPSAMTSTRPSRAATWPTPGTTPSSTTATPRAAPRRPVPGARP
PAEAFSSCPPCFSDLAHSAHQACPLNASPYYSSGRSSQQGGEEVSMSFTPAVKEVVEFAK
SIPGFQSLCQQDQVMLLKAGTFQVLMVRFSSLFNPKEKVVTFLSGETYSLCSLRTMGMGC
LLDAMFEFSEKLSSLGLDAQEMALFMAVVLVSADRSGISDVDAVEILQETLIRALRTLVT
KKHPDDSTLFPKLLLRLPDLRTLNNQHSEKLLAFRIDP
Download sequence
Identical sequences K7G8S3
ENSPSIP00000016684 ENSPSIP00000016684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]