SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000016823 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000016823
Domain Number 1 Region: 137-409
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.95e-43
Family Eukaryotic proteases 0.0012
Further Details:      
 
Domain Number 2 Region: 45-104
Classification Level Classification E-value
Superfamily GLA-domain 1.24e-23
Family GLA-domain 0.00046
Further Details:      
 
Domain Number 3 Region: 93-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000231
Family EGF-type module 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000016823   Gene: ENSPSIG00000014986   Transcript: ENSPSIT00000016901
Sequence length 410
Comment pep:known_by_projection scaffold:PelSin_1.0:JH224663.1:472676:489347:-1 gene:ENSPSIG00000014986 transcript:ENSPSIT00000016901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATCFWTICFLLFVLLVFQTEQTVFLSANNANQVISRHKRGTFLIIEEFFQGNLERECLE
ERCTYEEAREVYEDKEKTDTFWAGYFNGRQCSSNPCQHNGACQDSIRSYTCTCTDGYEGE
NCNFAKNECQYKTREGCQHFCYPGSESYHCSCAKGYELGEDKKSCIPRDQCACGRRDDGK
ILKMKEVMTFQRGFPWQVLLLDAEGKGFCGGVLMKSNFVLTTAECALVHNHSDIRVRTGN
NRMHGAGQVMDVNEKHIHMRYDEATGENNLALLQLREHIECNNYQRPICLPDKDFAEHVL
IPHLAGTVCGWKLEQSEVRDSLVELEVSYLPEGECEQVFNTSLTNRQYCGRRPEPVDMQL
AGGNFIANDYKGTWFLTGIFGGWPTDVSNWETFLFTKTSRYRMWFKQKTD
Download sequence
Identical sequences K7G962
ENSPSIP00000016823 ENSPSIP00000016823 XP_006139006.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]