SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000017021 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000017021
Domain Number 1 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-25
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 2 Region: 220-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 3 Region: 276-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.15e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 164-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.62e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 517-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.88e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-22
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 109-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 8 Region: 1-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-20
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 9 Region: 558-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-19
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 10 Region: 458-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.97e-16
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 11 Region: 70-122
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000184
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 12 Region: 323-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000022
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000017021   Gene: ENSPSIG00000015120   Transcript: ENSPSIT00000017099
Sequence length 614
Comment pep:novel scaffold:PelSin_1.0:JH208231.1:3510:15309:1 gene:ENSPSIG00000015120 transcript:ENSPSIT00000017099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVSFEEVAVYFSEEEWALLDPGQRALYWDVMQENYEAVSWLGFPVSKAHGISWVERGEEL
GTQKIPNQERPYTCSKCGKSFKLKAVLFLHQKIHSGEKPFRCPNCWKCFSRRSCLTEHQK
MHTGETPHNCSDCGKSFSQSSHLVLHQRVHTGEKPFRCTDCGKSFSGHSSLISHQRTHTG
EKPFNCSDCEKSFRRSSLLIRHRRIHTGEKPFDCSDCGKSFSGRSSLLIHQRIHTGEKPY
SCSECGKSFSRRSSLNIHHRTHTGEKPFNCSDCGKSFRGSSHLVTHRRIHTGEKPFDCSD
CGKSFSQHSHLINHQRTHTGEKPFSCSDCGKSFSQNTHLIKHQRIHTGEQPFSCSDCGKS
FSGPSSLIIHQRIHTGEKPYNCAECGKSFSQNSYLVRHRRIHTGEKPFSCPDCGKSFSES
PNLVRHRRIHTAEKPYNCSDCGKSFRQKSHLVVHQRIHTGEKPFRCPNCWKCFSRRSCLT
EHQKMHTGETPHNCSDCGKSFSQKSHLSSANPHRKNFSQRSELVRHWKIHTGEKPFNCSD
CGKSFRGSSHLVTHRRIHTGEKPFDCSDCGKSFSQHSHLINHQRTHTGEKPFSCSDCGKS
FSQNTHLIKHQRIH
Download sequence
Identical sequences K7G9R0
ENSPSIP00000017021 ENSPSIP00000017021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]