SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000017259 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000017259
Domain Number 1 Region: 520-766
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-62
Family Nuclear receptor ligand-binding domain 0.000000000591
Further Details:      
 
Domain Number 2 Region: 408-489
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.4e-27
Family Nuclear receptor 0.0000126
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000017259
Domain Number - Region: 294-333
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0235
Family Pentapeptide repeats 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000017259   Gene: ENSPSIG00000015245   Transcript: ENSPSIT00000017337
Sequence length 767
Comment pep:known_by_projection scaffold:PelSin_1.0:JH210279.1:1940706:2099363:-1 gene:ENSPSIG00000015245 transcript:ENSPSIT00000017337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPKESLSSLDGEEAEKNVHFRDKGRTVMDFHPTFRGGATVRAPASTSPLPTSSQSDSKQ
QPVLGDFSKGLVSNAPQPDLSKAVLLSMGLYMGETDAKVMGNELGFPQPGQIGISSGETD
FRLLEESIASLNKSASLTDSSKGTVSVGVPLERDFPIMANSNLPLGQAGTNGGNLKLFSE
DQSTFDILQDLELPSVSPGKEPNGSPWRLDPLLDEGDLLSPMTADESFLLEGNANEDCKP
PILPDTKPKINEHGDLLPSPKMQMPQVKTEKEDFIELCTPGVIKQEKMGPVYCQANFSGS
NLMGNKMSAISVHGVSTSGGQLYHYDLNTASLSQQQDQKPVFNVIPSLPAGSENWNRCQV
SGDDNMTPLGTLNFSGRPVFSNGYLSPGVRSDASSSPSTASTATGPPPKLCLVCSDEASG
CHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEA
RKTKKKIKGIQQSSVTAARDASESPVSKTIVPASLPQLTPTLVSLLEVIEPEVLYSGYDS
TLPDSTWRIMSTLNMLGGRQVVAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGW
RSYRQSNGNLLCFAPDLIINEQRMNLPCMYDQCKHMLMVSNELSRLQVSYEEYLCMKTLM
LLSTVPKEGLKSQALFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHDVVE
NLLNFCFQTFLDKSMSIEFPEMLAEIISNQIPKYSNGNIKKLLFHQK
Download sequence
Identical sequences K7GAE8
XP_006128608.1.96668 ENSPSIP00000017259 ENSPSIP00000017259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]