SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000017696 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000017696
Domain Number 1 Region: 534-595,826-1177
Classification Level Classification E-value
Superfamily Ras GEF 5.75e-118
Family Ras GEF 0.000015
Further Details:      
 
Domain Number 2 Region: 129-352
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-43
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 3 Region: 340-485
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000959
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000017696
Domain Number - Region: 2-62
Classification Level Classification E-value
Superfamily PH domain-like 0.00411
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000017696   Gene: ENSPSIG00000015555   Transcript: ENSPSIT00000017775
Sequence length 1180
Comment pep:known_by_projection scaffold:PelSin_1.0:JH209116.1:7550465:7690211:1 gene:ENSPSIG00000015555 transcript:ENSPSIT00000017775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QYFFTVIFGHEGQKPLELRCEEESDGDEWVEAIHQASYSDILIEREVLMQKYIHLVQIVE
TEKIAANQLRHQLEDQDTEIERLKSEIVALNKTKERMRPYQGNQEDEDPDIKKIKKVQSF
MRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFNMVEAESEYVHQLYVLVNCFLRPLRM
AASSKKPPINHDDVSSIFLNSETIMFLHEIFHQGLKARISNWPTLILADLFDILLPMLNI
YQEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQIPRYIITL
HELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLD
TSQTFIRQGSLIQVPSVERGKLSKVRLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHL
LKTGGVLSLIECTLIEEPDVSDDDSKGSGQVFGHLDFKIVVEPTDAPPYTVVLLAPTRQE
KAAWILANTIKCVDNIRCNGLMTIVFEENSKVTVPHMIKSDARLHRNDIDICFSKTLNSC
KVPQIRYATVERLLERLTDLRFLSIDFLNTFLHTYRIFTTATVVLEKLSDIYKRPFTSIP
VRSLELFFATSQNNREHLADGKSPHLCRKFSSPPPLSLSRTSSPVRIRKLSLTNSPLNSR
IGALDLSTSSVASSPTSTYSPATSPPPTASKVPLDLSKGPSSPEQSPGSIEPPHSAPPAS
SQIFLNMAHLSSVLESVSVDRTIPESTSTVETPEFSPCRSPSTPRHLRYRQAGAITEFLF
IFTWCAGVLDNMNIDILTADNCHCSVSPASAFAIATAAAGHGSPPVKEIYSREELSHTGF
NNSERMCDKEFIIRRAATNRVLNVLRHWVSKHSQDFELNNEMKMNVLNLLEEVLRDPDLL
PQERKATANILRALSQDDQDDTHLKIEDIIQMSECPKPECFETLSAMELAEQITLLDHIV
FRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVGSRANSIEKW
VAVADICRCMHNYNGVLEITSALNRSAIYRLKKTWAKVSKQAKALMDKLQKTVSSEGRFK
NLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQ
TSYRIEHQQKVTHYLLDKTLIIDEDTLYELSLKIEPRLPA
Download sequence
Identical sequences K7GBN5
ENSPSIP00000017696 ENSPSIP00000017696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]