SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000018339 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000018339
Domain Number 1 Region: 223-462
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-66
Family Nuclear receptor ligand-binding domain 0.0000000165
Further Details:      
 
Domain Number 2 Region: 14-99
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.99e-31
Family Nuclear receptor 0.0000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000018339   Gene: ENSPSIG00000016262   Transcript: ENSPSIT00000018425
Sequence length 469
Comment pep:novel scaffold:PelSin_1.0:JH210437.1:1063271:1074361:-1 gene:ENSPSIG00000016262 transcript:ENSPSIT00000018425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCFVPLPAAAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCSRQRNCL
IDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQSQEQNGTAKDA
AEALARVYPTSVSSGVSDLDDISPLSDGLLFDFPLTPDGGSTYYNLDLLTSAQPSPDPSS
MDLSDAKLAKQESFYELMLEPGVFAHDPLEGSQLASDMSLLEIDRVAQNVVKSHLETCQY
TVEELKGLAWMLYTQEEIRSLQNKSCETMWLQCSLQLSNAIQYVVEFAKRLDGFLELCQN
DQILLLKAGCLEVLLIRMSRAFNPLNNTVLFEGKYGGMQIFKSLGCDDLINAIFELGRNL
CRLQLSDEEMALFTAAVLLSPDRPWLTESKKVQKLQDKIYLALQHEIQKKHSSEDKLSKM
VAKLPFMKTICNLHLDKLEFFRLLHPETAMSFPPLYKEVFNSELQYSDP
Download sequence
Identical sequences K7GDH8
ENSPSIP00000018339 ENSPSIP00000018339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]