SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000018473 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000018473
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily PH domain-like 7.07e-33
Family Phosphotyrosine-binding domain (PTB) 0.0000145
Further Details:      
 
Domain Number 2 Region: 284-380
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-27
Family SH2 domain 0.0000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000018473   Gene: ENSPSIG00000016419   Transcript: ENSPSIT00000018559
Sequence length 387
Comment pep:known_by_projection scaffold:PelSin_1.0:JH211314.1:4575761:4613944:1 gene:ENSPSIG00000016419 transcript:ENSPSIT00000018559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNITLNISTTSLNLMTPDSKQIIANHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHI
LECCDDLAQDVISTIGQAFELRFKQYLRCPSKIPALHDRMQSFDEPWMEENGESVEHPYY
NSIPNKMPPIGGFIDARFKTRIPNAADTAQSATAAGREQTYYQSRHLGDKFSEDWQHVPV
KQGSLDIYSVPEGKLQVTVTGEVPAYVNTQHINMEALLPLQADAESIFSGTKDYTKDSSP
RKDLFDMKPFEDALKNQTTGSVLNKATSVECTSPLSRAASCGIMDELNTEPWYQGEMSRK
EAEQLLKKCGDFLVRKSTTNPGSYVLTGMHNRQAKHLLLVDPEGTVRTKDRVFDSISHLI
NHHLANNLPIVSAGSELCLQQPVERKQ
Download sequence
Identical sequences K7GDW2
ENSPSIP00000018473 ENSPSIP00000018473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]