SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000018860 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000018860
Domain Number 1 Region: 96-115,144-363
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.06e-60
Family Nuclear receptor ligand-binding domain 0.0000000584
Further Details:      
 
Domain Number 2 Region: 70-103
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000316
Family Nuclear receptor 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000018860   Gene: ENSPSIG00000016751   Transcript: ENSPSIT00000018946
Sequence length 365
Comment pep:known_by_projection scaffold:PelSin_1.0:JH210532.1:306878:313218:1 gene:ENSPSIG00000016751 transcript:ENSPSIT00000018946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRDHRAEFFIKTEPASPDSLAQRSPSGSSDASGPPHDLEPGALTRRRHDQNPDEASPR
GKYVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGVRLDRVRGGRQKYKRRP
EVDGAPFPNTFATPQIATATSKKPAPINPMVSHLLVAEPEKLYAMPDPALPDGPLRATSA
LCDLADREIVVIIGWAKNIPGFPALSLADQMSVLQSAWLEVLVLGVAWRSLPCEDEVVFA
EDFALDEEGARAAGLWELSAALLQLVRKYRALRLEREEYVLLKALALANSGGSCLMKGWD
VLHEALLEYESSRRPEEPCRAGKLLLTLPLLRQTAARALHHFYGIKLGGKVPMHKLFLEM
LEAMM
Download sequence
Identical sequences K7GEZ9
ENSPSIP00000018860 ENSPSIP00000018860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]