SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000018891 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000018891
Domain Number 1 Region: 135-381
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.87e-61
Family WD40-repeat 0.00021
Further Details:      
 
Domain Number 2 Region: 375-419
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000157
Family SOCS box-like 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000018891
Domain Number - Region: 36-115
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.051
Family DPP6 N-terminal domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000018891   Gene: ENSPSIG00000016749   Transcript: ENSPSIT00000018977
Sequence length 421
Comment pep:known_by_projection scaffold:PelSin_1.0:JH224660.1:2911473:2925167:-1 gene:ENSPSIG00000016749 transcript:ENSPSIT00000018977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFPPSVNEKLIARSRPIGELLAPTSPFDKKCGRENWTVAFAPDGSYFAWSQGHRIVKL
VPWTQCFNNFLLHGTKNVPNSVNSRLSRQNSDSGQKNKPCEHIIDCGDIVWSLAFGSSVP
EKQSRCVNIEWHRFKFGQDQLLLATGLNNGRIKIWDAYTGKLLLNLMDHTEVVRDLTFAP
DGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVYGCAFSPDSSILCSVGASKAVFL
WDMDKYTMIRKLEGHHNDVVACEFSPDGALLATASYDTRVYVWDPHIGVILMEFGHLFPA
PTPIFAGGANDRWVRSVSFSHDGLHIASLADDKMVRFWSIEEDYPVQVAPLSNGLCCAFS
TDGSVLAAGTHDGSVYFWATPKHVSSLQHLCRMAIRRVMPTSQVRNLPVPSKVVEFLSYQ
I
Download sequence
Identical sequences K7GF30
XP_006138653.1.96668 ENSPSIP00000018891 ENSPSIP00000018891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]