SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000019296 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000019296
Domain Number 1 Region: 94-212
Classification Level Classification E-value
Superfamily PX domain 1.68e-16
Family PX domain 0.002
Further Details:      
 
Domain Number 2 Region: 290-345
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000135
Family SAM (sterile alpha motif) domain 0.0064
Further Details:      
 
Domain Number 3 Region: 879-910
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000117
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000019296   Gene: ENSPSIG00000017111   Transcript: ENSPSIT00000019386
Sequence length 934
Comment pep:known_by_projection scaffold:PelSin_1.0:JH224637.1:2685426:2805946:-1 gene:ENSPSIG00000017111 transcript:ENSPSIT00000019386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNHPAFSFHQKQVLRQELTQIQNIMASTSKNPSIPTLSAMATYPGCHKVTPRSETPIN
TVGNSLENALHTSAHSIEESLPKRSSGKHSKVSVEKVEVKGLAHKKNERNVEYSFEVLWS
DSSVTLVTKSSGEVTEFISKLSQMYPEENLEKFIPCLAGPDSFYLERNHMDLESDVRYLA
SLPSHVLKNDHVKKFFSTSSSSQQLQSSNPGNPSLYKVVTTLGASGRPVCGVAGIQSSQN
HVQHSAVSSVALPHCSHSGSTGSSLAYRSQADTSSPMLSSSPQTPQTQEQNGILDWLRKL
RLHKYYPVFKQLTMEKKFLSLTEEDLNKFESLTMGAKKKLKTQLELEKEKSEKRCLNPAT
PSSVTSSGVARVPPTTHVGPIQSIRGNHAAELRVDVDQPAHPLPREGSSSEYSSSSSSPM
GIQTREESSDSAEENERRLEIHLDSSEKEKPVMLLNHFTSSSARPTAQVLPVQNDAGSNP
SGHHTLPMQMMTAASTHISPIRMLNSMHKSERNTDMKLLSSSVHSLLSLDERNKVSPGPR
SSVKMDKSFGNTVVDVMPTSSPHQPLQVLSGVPENSSSSTVNFGPRTKVVHASTLDRVIK
TTQQTSLIAESSTAATVTSSSVFHMARPPIKLLVSSSVPTDSATTGQTSCSSNMQISVSP
AIINPRTALYTANTKVAFSGMSSMPVAPMPGSFCANSSTASSSSHPSTSFANMANLSSCP
VPSSSPTLSSVAENNFYSSGGGGSAASIPVPNQNHHHHHHQQPQPQPPGCMVCSSCGCSG
NCGSGGMTVSYANYFQHPFSGSSMFTFPFLPFNPLCSNGYVNTQQYNGSTTFPVVHSPYN
SGLTPDSVMSGQSTFAVPPMQNFMAGAAGVYQAQGMMGNSNGSSHKKNGNLSCYNCGASG
HRAQDCKQPPMDFNRQGTFRLKYAPPAESVDSTD
Download sequence
Identical sequences K7GG85
ENSPSIP00000019296 ENSPSIP00000019296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]