SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000019343 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000019343
Domain Number 1 Region: 142-397
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-71
Family Nuclear receptor ligand-binding domain 0.00000762
Further Details:      
 
Domain Number 2 Region: 73-155
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.01e-31
Family Nuclear receptor 0.000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000019343   Gene: ENSPSIG00000017164   Transcript: ENSPSIT00000019433
Sequence length 411
Comment pep:known_by_projection scaffold:PelSin_1.0:JH209718.1:1304103:1309706:-1 gene:ENSPSIG00000017164 transcript:ENSPSIT00000019433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVVGAWRDPQDDVPGAQGTQPSQVPPVQGPPAGAPHTPQTPGQGGAPSTPAQTNQPSQ
QSQGGDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPI
DQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYIS
LLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVA
LLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLK
ALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKL
LLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQ
Download sequence
Identical sequences K7GGD2
ENSPSIP00000019343 XP_006126935.1.96668 ENSPSIP00000019343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]