SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000019431 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000019431
Domain Number 1 Region: 173-293
Classification Level Classification E-value
Superfamily TIMP-like 4.87e-36
Family Netrin-like domain (NTR/C345C module) 0.0003
Further Details:      
 
Domain Number 2 Region: 33-146
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-33
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000019431   Gene: ENSPSIG00000017254   Transcript: ENSPSIT00000019522
Sequence length 293
Comment pep:known_by_projection scaffold:PelSin_1.0:JH209112.1:1062368:1094238:1 gene:ENSPSIG00000017254 transcript:ENSPSIT00000019522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVQMISDANTAGNGFIAMFSAAEPHERGDQYCGGRLDKPSGSFKTPNWPDRDYPAGVTC
SWHIVAPRNQVIELKFEKFDVERDNYCRYDFVAVFNGGEINDAKRIGKYCGDSPPAPIVS
ERNELLVQFLSDLSLTADGFIGHYKFRAKKLPTTTAPATTTPFATATLKPTVALCQQKCG
RNGTPESNYCSSNFVITGTVITAVTRGGSLHATISIINVYKEGNLAIQQAGKNMSTKIIV
VCKQCPLIRRGLNYIIMGQLEEDGRGKILPNNFVMSFKTKNQKTLNTLKNKRC
Download sequence
Identical sequences K7GGM0
ENSPSIP00000019431 ENSPSIP00000019431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]