SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000019826 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000019826
Domain Number 1 Region: 3-342
Classification Level Classification E-value
Superfamily L domain-like 2.21e-66
Family Internalin LRR domain 0.043
Further Details:      
 
Domain Number 2 Region: 764-863
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-27
Family PDZ domain 0.00011
Further Details:      
 
Domain Number 3 Region: 909-1001
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-25
Family PDZ domain 0.0041
Further Details:      
 
Domain Number 4 Region: 1002-1100
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-24
Family PDZ domain 0.0000352
Further Details:      
 
Domain Number 5 Region: 631-726
Classification Level Classification E-value
Superfamily PDZ domain-like 1.08e-23
Family PDZ domain 0.0000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000019826   Gene: ENSPSIG00000017530   Transcript: ENSPSIT00000019920
Sequence length 1464
Comment pep:known_by_projection scaffold:PelSin_1.0:JH210345.1:195846:422618:-1 gene:ENSPSIG00000017530 transcript:ENSPSIT00000019920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPFFRLLNLRKLGLSDNEIQRLPPEVANFMQLVELDISRNDIPEIPESIKFCKSLEIADF
SGNPLSRLPEGFTQLRSLGHLALNDVSLQSLPSDIGNLANLVTLELRENLLKALPTSLSF
LVKLEQLDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVCLDVSENKL
EHLPNELSGLVALTDLLLSQNLLESIPDGIGQLKQLSILKVDQNRLVEVTESIGDCENLS
ELILTENVLTALPKSLGKLTKLTNLNVDRNRLTALPSEIGGCASLNVLSLRDNRLALLPP
ELANTTELHVLDVAGNRLQNLPFALTNLNLKALWLAENQSQPMLKFQTEDDEKTGEKVLT
CYLLPQQPSPSLGKRSHENLLQNSVDESWTDTNLNRVSVIQFLDEPRADDEEEAGAEKRG
LQRRATPHPSELKVMKKVIEVRRNEMYSAKPDVNPDSPDSEEKRLSAMSSRSEDSHVSNS
TVSANFREEEEVGAGGTRPNGQVPEKQELESEPSVHFAEDTLVRSEEEDDDDERPFPVEK
QRLIRKDTPHYKKHFKITKLPKPEAVVALLQGLSSDGVPEEEERGGCSNSVEPPEQEEAW
DEDSVKDGALPTQPSVKGVSFDQANNLLIEPARIEEEELTLTILRQTGGLGISIAGGKGS
TPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALHSAEHHVAVDALRGSGSSVS
MTVLRERMVEPENAITVTPLRPEDDYSPREPRGGLRFPERPEGAPPTERFSTCLVRNEKG
LGFSIAGGKGSTPYKAGDMGIFISRIAEGGAAHRDGTLRVGDRVISINGVDMTEARHDQA
VALLTASSPTIALLVEREGAEQLSEGDSPVAPRAHSPPPPSSHGESPPEETALLQRDHLS
KGLEDQYPIEEICLIKAGGPLGLSIVGGSDHSSHPFGIQEPGVFISKVIPHGLASRSGLR
VGDRILEVNTIDLRHATHQEAVNALLSSTQALSMLVRRDPPPPGMQEICIEKAPGEKLGI
SIRGGAKGHAGNPFDPTDEGIFISKVSSSGAAARDGRLKVGLRILEVNHQSLLGMTHTEA
VQILRSVGDKLLVLVCDGFDPKAAAAIEMSPGIIANPFAAGIGRKNSLESISSIDRDLTP
EELEILQKEMEMVREATQWEREEMEKVNISSEPLRLDYRTLAALPTNNFPRVTRAVSDGA
SLRLLPLLSLSLQLRPHAPPSPEDVPVNVKQAYKTFAAVPQSHSLLEPQMLSPGGLHSPE
QRSFRERQKYFEMEVKQQQVEKPPKRVSLVGEDDLKKMKEEEARKLQQKRALLLEEEEEE
EEEDAGKPDMSMQSSVIIEGVEYKIKRLNGRSIQSPATRLIPVYPGGEAGAPVRTAKAER
RHQERLRMQSPEFLSTQEKELSPAERRALEAEKRAMWRAARMKSLEQDALKAQMVIAKSK
EGKKRSTLEQLAESPSPAPTPSPT
Download sequence
Identical sequences K7GHR5
ENSPSIP00000019826 ENSPSIP00000019826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]