SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000020258 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000020258
Domain Number 1 Region: 212-356
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-45
Family Third domain of FERM 0.000000226
Further Details:      
 
Domain Number 2 Region: 102-211
Classification Level Classification E-value
Superfamily Second domain of FERM 8.37e-38
Family Second domain of FERM 0.00000104
Further Details:      
 
Domain Number 3 Region: 512-600
Classification Level Classification E-value
Superfamily Moesin tail domain 3.14e-32
Family Moesin tail domain 0.0000229
Further Details:      
 
Domain Number 4 Region: 18-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.51e-26
Family First domain of FERM 0.0000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000020258   Gene: ENSPSIG00000017922   Transcript: ENSPSIT00000020353
Sequence length 600
Comment pep:known_by_projection scaffold:PelSin_1.0:JH206637.1:8180535:8212509:-1 gene:ENSPSIG00000017922 transcript:ENSPSIT00000020353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FIHLIFVPLQYLIVCFKLNVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGL
QYTDNKGFLTWLKLDKKVSAQEVKKENPLQFKFRAKFFPEDVSEELIQDITQKLFFLQVK
EGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEAHKPGYLNSERLIPQRVMDQHKLSREQ
WEERIEVWHAEHGGMLKENAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNI
YEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGN
HELYMRRRKPDTIEVQQMKAQAREEKHQKQMERQQLENEKKKRETIEREKEQMLREKEEL
MVRLQEYEIKTRKAEKELSDQVQKALQLEEERRRAEKEAERLETERLAALQAKEELEKQT
VDQMKSQEQLAAELAEYTAKIALLEEARKRKENEVEEWQHRAKEAQDDLVKTKEELHLVM
TAPPPPPPAPVYEPVNYHVHDNLHDEGTEYSGYSAEFSSEGILGDRNEEKRITEAEKNQR
VQRQLMTLTDELAQARDENKKTHNDMIHTENMRQGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences K7GIZ7
ENSPSIP00000020258 ENSPSIP00000020258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]