SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000020581 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000020581
Domain Number 1 Region: 222-235,277-524
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.2e-62
Family Nuclear receptor ligand-binding domain 0.00000000341
Further Details:      
 
Domain Number 2 Region: 171-250
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-25
Family Nuclear receptor 0.0000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000020581   Gene: ENSPSIG00000018210   Transcript: ENSPSIT00000020678
Sequence length 556
Comment pep:known_by_projection scaffold:PelSin_1.0:JH211942.1:368835:417775:-1 gene:ENSPSIG00000018210 transcript:ENSPSIT00000020678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMCASSHKEFSQLLPIQDIGRSKTEIKSSPSGINSPVYSCSQSVLTMEQSPIYIPSSYV
ENRHEYSAMAFYSPTMMNYNIPSNFSDSESASVRQTSSPNVLWSAPGHISPLTLHSQPSL
LYAEQPKSPWCETRPVDHALPMNRETLKRKPNGSDFTSPAVNSPGSKRDAHFCAVCSDYA
SGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCCEVGMMK
CGSRRDRCGYRIIRRHRNSEDQAHCSGKAKKNSENATRVKEILLSALNPEQFVLTLLEAE
PPNVLLVSRPNKPFTEASMMMSLTKLADKELVHMIGWAKKIPGFIELSLYDQVRLLESCW
MEVLMMGLMWRSIDYPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHK
EYLCVKAMILLNSSMFSLSAATEEPESNRKLHHLLNTVIDALVWVISKSGIPSQQQTTRM
ANLLMLLSHVRHASNKGMEHLLSMKCKNVVPVYDLLLEMLNAHTLRGQRKSAVTDSDYVP
AEQTDTRGSTWNMAAQ
Download sequence
Identical sequences K7GJX0
ENSPSIP00000020581 XP_006134140.1.96668 ENSPSIP00000020581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]