SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000020596 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000020596
Domain Number 1 Region: 187-450
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.44e-84
Family Nuclear receptor ligand-binding domain 0.00000000024
Further Details:      
 
Domain Number 2 Region: 82-166
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-27
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000020596   Gene: ENSPSIG00000018221   Transcript: ENSPSIT00000020693
Sequence length 451
Comment pep:known_by_projection scaffold:PelSin_1.0:JH209943.1:6890461:6948714:1 gene:ENSPSIG00000018221 transcript:ENSPSIT00000020693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISETPYLESSYKSWKTYRTSLSIGDDSSGALSVTELHSLGNGPGSEGSVITDTLSPASS
PSSINVATVPNSIDESSSGALNIECRICGDKASGFHYGVHACEGCKGFFRRTIRLKLTYD
KCDRTCKIQKKNRNKCQYCRFQKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTGEQDVED
SEMADLKSLAKGIYEAYLKNFNMNKVKARVILAGKTNNNPPFVIHDMETLCMAEKTLVAK
LVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKSIPGFSNLDLNDQVTLLKYGVYEAI
FAMLASVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISL
FVAAIICCGDRPGLVNVEYIEKMQESIVHVLKLHLQNNHPDDIFLFPKLLQKMADLRQLV
TEHAELVQIIKKTESDAPLHPLLQEIYSDMY
Download sequence
Identical sequences K7GJY5
ENSPSIP00000020596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]