SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000020600 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000020600
Domain Number 1 Region: 200-467
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.09e-80
Family Nuclear receptor ligand-binding domain 0.000000000273
Further Details:      
 
Domain Number 2 Region: 95-179
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-27
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000020600   Gene: ENSPSIG00000018221   Transcript: ENSPSIT00000020697
Sequence length 468
Comment pep:known_by_projection scaffold:PelSin_1.0:JH209943.1:6893156:6948714:1 gene:ENSPSIG00000018221 transcript:ENSPSIT00000020697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDTENQLCPLEEDDLRNPLSREFLQVMENIQDFSSIGDDSSGALSVTELHSLGNGPGSE
GSVITDTLSPASSPSSINVATVPNSIDESSSGALNIECRICGDKASGFHYGVHACEGCKG
FFRRTIRLKLTYDKCDRTCKIQKKNRNKCQYCRFQKCLSVGMSHNAIRFGRMPRSEKAKL
KAEILTGEQDVEDSEMADLKSLAKGIYEAYLKNFNMNKVKARVILAGKTNNNPPFVIHDM
ETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKSIPGFSNLDLND
QVTLLKYGVYEAIFAMLASVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMK
FNALELDDSDISLFVAAIICCGVLRTDRPGLVNVEYIEKMQESIVHVLKLHLQNNHPDDI
FLFPKLLQKMADLRQLVTEHAELVQIIKKTESDAPLHPLLQEIYSDMY
Download sequence
Identical sequences K7GJY9
ENSPSIP00000020600 ENSPSIP00000020600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]