SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000000197 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000000197
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000403
Family Fibronectin type III 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000000197   Gene: ENSPSIG00000000198   Transcript: ENSPSIT00000000197
Sequence length 217
Comment pep:novel scaffold:PelSin_1.0:JH224652.1:6530865:6531518:-1 gene:ENSPSIG00000000198 transcript:ENSPSIT00000000197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIEVRNISGTRATVSWSANIPCPENYYHVLYRPNWNSVFAGYFRQNFHREERVPHSLNH
LVLHRLTPSTVYILCITCKNSYPSSNHCTTFHTLNQHPLAWRGLKQESATSMWMVSSLLL
LCFAAFLVFGCLQFWSSRCRKGSWLQQYSADPEREAGEQTGSPEGTGMKEELLEVPMTSV
RMSSNFTTESPHRSPRRFFPLRSSDDKRAILPQHRLK
Download sequence
Identical sequences K7EWN7
XP_006138353.1.96668 XP_006138354.1.96668 ENSPSIP00000000197 ENSPSIP00000000197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]