SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000000986 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000000986
Domain Number 1 Region: 117-202
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000571
Family Fibronectin type III 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000000986   Gene: ENSPSIG00000000989   Transcript: ENSPSIT00000000988
Sequence length 285
Comment pep:novel scaffold:PelSin_1.0:JH207378.1:62290:63147:1 gene:ENSPSIG00000000989 transcript:ENSPSIT00000000988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTILLGLSAPVLTATCLLILCPGAAPTSMGGSLPLPPKGQSHWPWLHAQASSPLVFPTSQ
DDLETDYYSYEDFTQDTPKMPGSQSPPDQPCDYHRCRHLQPACAELSRETGCLCPGVTGP
GVPPEPPQLGTVHITESGASLHWCAPSSTVREYRVMYQADGEPPIAGPIFNSTFRMAALG
GLCPSTSYLVCIIAANQAGASPTDSGSQAHGPCRTIRTLASQQPYAYVAAGLAAMLCLVV
VAALIWHFALRVRRRQFHGSRDNILNGEVGPAGVANGSYGGEEQL
Download sequence
Identical sequences K7EYX6
XP_006118286.1.96668 ENSPSIP00000000986 ENSPSIP00000000986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]