SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000003415 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000003415
Domain Number 1 Region: 517-656
Classification Level Classification E-value
Superfamily PH domain-like 6.85e-37
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 2 Region: 180-281
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-16
Family PDZ domain 0.014
Further Details:      
 
Domain Number 3 Region: 6-62
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000402
Family SAM (sterile alpha motif) domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000003415   Gene: ENSPSIG00000003264   Transcript: ENSPSIT00000003432
Sequence length 1013
Comment pep:novel scaffold:PelSin_1.0:JH206737.1:1429982:1831024:-1 gene:ENSPSIG00000003264 transcript:ENSPSIT00000003432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLDDCLQQYIKNFEKEKINGEQLLHITHQELEELGVTRIGHQELILEAVDLLCALNYGLE
TENLRTLSHKLNASAKNLQNFITGRRRSGHYDGRASRRLPNDFLTSVVDLIGAAKNLLAW
LDRSPFVSVTEYSLLKNNIVQLCLELTTIVQQDCTVYETENKILHVCKTLSGICDHIISL
SSDSLVSQSAHLEVVHLTSILPSEGLGMYIKSTYDGLHVITGTTENSPADQCKKIHAGDE
VIQVNHQTVVGWQLKNLVNALREDPNGVILTLKKRPQNTLVSAPALLKNVRWKPLALQPV
IPTSPTSSSTTPTSTMGMSSKIDSSALQDIFILSPMSGLYSPRDEVGIVSCHDISKYGKS
GMKGSESPSYFLEHESGKYYTLIEGEGHPMGSEFERGRTTGVRRREKTPTHGDLRPVSMP
TEFSWIGESKEPNMYKRGSRAENSLLRYLSDDKILVIQEEPLTQKDNKRDTGRRSRKKGK
NTSNLNYPITPSMLTSAVSVRLEPGQQDVLNFSLAESNTVPLYHSFHYASLRVKTKKWSK
GSSLTSGSRRRISCKDLGHGDCEGWLWKKKDAKGYFTQKWKKYWFILKDSSLYWYTNQND
EKAEGFISLPEFRIDRAIECRRKHAFKACHPKIKSFYFATDCLEEMNRWMNRLGLAAIGY
TPDDKDIRPDEADYWSESDQDDIDGSLTLKQEGPSTLCDIYHRTLSVNSSSPFPEPKHGR
HFSSESTYSYSSAEDSRQDATGSTHSSGCRPPYRERRSWQDLIETPLTSSGLHFLQTVPP
DPEYVSGRPGMSPERRRQATLPVQRRHNHERDGPFPLVEWQRGYSSHNRPQKQRSQSLPR
NRDVRSKGHVKSSGISEEKPEGKLLIKKQNSFCEEENIKEIREGTDGLQELYKSLEQASL
SAFGEQRPSTKQEFRKSFVKRCNDPVINEKLHHIRVLKSTLKAKEGDLITINNLLDDPSL
TSKKFKEWKLKNYDFFLDICEYSTALNPQNGASELTSPAPLLTHTHSFIETHV
Download sequence
Identical sequences K7F5V5
ENSPSIP00000003415 ENSPSIP00000003415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]