SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000003505 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000003505
Domain Number 1 Region: 187-329
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-37
Family Third domain of FERM 0.0023
Further Details:      
 
Domain Number 2 Region: 84-189
Classification Level Classification E-value
Superfamily Second domain of FERM 6.54e-32
Family Second domain of FERM 0.000075
Further Details:      
 
Domain Number 3 Region: 2-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.36e-26
Family First domain of FERM 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000003505   Gene: ENSPSIG00000003336   Transcript: ENSPSIT00000003522
Sequence length 371
Comment pep:novel scaffold:PelSin_1.0:JH212600.1:54538:232683:-1 gene:ENSPSIG00000003336 transcript:ENSPSIT00000003522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCPIRLLDDSEISCHIQKETKGQFLIDHICNYYSLLEKDYFGIRYVDPEKQRHWLEPNK
SISKQMKSHPPYTMCFRVKFYPHEPLKIKEELTRYLLYLQIKRDIFHGRLLCSFSDAAYL
GACIVQAELGDYDPDEHPENYISNFKIFPKQSQKLERKIAEVHQNEFRGQSPAVAEFNLL
LKAHSLETYGVDPHPCKDSTGTTTFLGFTATGFVVFQGNKRIHLLKWADVCKLKYEGKTF
YVLGAQKEKKAVLSFHTSTPAACKHLWKCGVENQAFYKYAKSSQIKTMSSSKIFFKGSRF
RYSGKVAKEVVEASSKIQREPPEVHRTNIPQSRSSHSLNKQLIINMEPLQPLLPSPSEEE
EVPLDEGESLI
Download sequence
Identical sequences K7F645
ENSPSIP00000003505 ENSPSIP00000003505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]