SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000003548 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000003548
Domain Number 1 Region: 117-223
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-29
Family Second domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 226-369
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-28
Family Third domain of FERM 0.0038
Further Details:      
 
Domain Number 3 Region: 14-117
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.82e-18
Family First domain of FERM 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000003548   Gene: ENSPSIG00000003374   Transcript: ENSPSIT00000003566
Sequence length 622
Comment pep:novel scaffold:PelSin_1.0:JH208705.1:759172:803314:-1 gene:ENSPSIG00000003374 transcript:ENSPSIT00000003566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSLLQSRMQQEYRNVCVLLPNREQLSVTIGVKATGQELFQQVCDLVKIKDPHFFGLSI
IKNNEYVFMDLEQKLSKYFSKEWKKETNKVERYFVQQGTEKFTPPFVAFFRVQYYVENGR
VISDKAARHLYYCHLKEQVLRSRCSHKEEIYFLLAAYSLQADLGSYAENVHVGKYFEPQA
YFPQWIIAKRGSDYILKHAPEIHQEQKGLSTKDAILQFIKESCLLEDVPVHYFRLQKDKK
EDRPTVVLGLTLKGIHIYQEVNHVRQLLYDFPWSHIGKLAFLGKKFEIQPDGLPSARKLV
YYTGCPFRSRHLLQLLSNSHRLFLNVQPVLKQIQKLEEVEEKKRYRESYISDTLEMDLDP
SDKHSHGSGSSGGSQRVNRLSRQSTGSHGSSHTSGIEADSRHRMSVEMSVDEPFSIERVH
RKEKSCSSTVSCGSSGIDSGGKGRVEEDSQDDEVELAVDDPVERNQLEEAAEAVHLLYVT
LKTYVTRSSKGINLCLLQQAEKAQDIGLVTLIQMRGQSVESLHQTVCRDPNLGRSCADQH
SQSLDDIRLYKHQHPPISSTLSSDTSHSYTFGCALDDKLASYGCVYSTADCKTKSALYGK
RSMNCLSLDLLGEDQLPEEFVV
Download sequence
Identical sequences K7F688
ENSPSIP00000003548 ENSPSIP00000003548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]