SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000003553 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000003553
Domain Number 1 Region: 195-324
Classification Level Classification E-value
Superfamily Second domain of FERM 3.01e-30
Family Second domain of FERM 0.002
Further Details:      
 
Domain Number 2 Region: 108-189
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000173
Family Ras-binding domain, RBD 0.06
Further Details:      
 
Domain Number 3 Region: 327-395
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000307
Family Third domain of FERM 0.014
Further Details:      
 
Domain Number 4 Region: 18-63
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000486
Family PDZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000003553   Gene: ENSPSIG00000003382   Transcript: ENSPSIT00000003571
Sequence length 435
Comment pep:novel scaffold:PelSin_1.0:JH208621.1:1241258:1252619:-1 gene:ENSPSIG00000003382 transcript:ENSPSIT00000003571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XXXXXXXXXXXXXXXXXADGKLLPGDQILSINHEAVEHVSIEQAAGLLRDPEDSLLLTVL
RCTSGGPKSSFLTAEKRARLKTNPVKVRFAEEVLVNGHSQGNSLLCLPNVLKVYLENGQT
KAFRFDATTTVKDILLTLKEKLSIHCIEHFALALEEQYNIAKVYLLHEEELIEQVVQRKD
AHDYRCLFRVCFVPKDPLDLLQDDPVTFEYLYLQSCSDVLQERFAVEMKCSVALRLAALH
IQERIYACAQPQKVSFKYIAKDWGIENFISPTLLRNMKGKDIKKAISFHMKRNQILLEPR
QKHALSASAVRLSYLQILGDLKMYSGKIFNATLMLQDRESYVALLVGAKYGISQIINNKL
NIITPLAAFANISRLEFSEESEKVSTVKIYLQDVKVIAGSQGARAGRAALGPCRLHATGT
PGGRRNAAGTVPWFS
Download sequence
Identical sequences K7F693
ENSPSIP00000003553 ENSPSIP00000003553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]