SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000004088 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000004088
Domain Number 1 Region: 127-266
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-19
Family Second domain of FERM 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000004088   Gene: ENSPSIG00000003850   Transcript: ENSPSIT00000004111
Sequence length 463
Comment pep:novel scaffold:PelSin_1.0:JH211041.1:1002079:1019945:1 gene:ENSPSIG00000003850 transcript:ENSPSIT00000004111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGADGAAVPPSLADRSHRSSISSTCARSLDVLVYLIDDTAVRLNVENLTSVTVHELHRI
VRDALQFPECAMEVFSLWLISPLLEVQLKPKHQPYKVCRQWQELLFRFTDCPEDEIMQDE
PSLQFRRNVFFPKRRELQIENEAVLRLLYEEAKFNILEGRYPCDAEDCEQLGALVCRLQL
GPYDQDQHTACALKEKLESFLPAHLCRRGHSLLAALRKRGAKQPAYEQGLFQAYQAVREE
AACGEPEALLQHYRAYLQRCHQLPYYGCAFFYGEIDKPAQGFLHRGGRKAVSVAISLEGV
YVIDSKEKHVLLGLQFQELSWDHTYPDEEEEHILWLEFDGESEGTLVNKLLKIYSKQAEL
MNGLIEYCIELNAAAEASVPENSTSQSPTLTPLASRQRPKLRRQNSVVSSRIQHLTTIDY
IEDGKEIKRVKPKRTASFFSRQFSHSPTAYSAVQAPAESLEQG
Download sequence
Identical sequences K7F7S8
ENSPSIP00000004088 ENSPSIP00000004088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]